SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000056160 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000056160
Domain Number 1 Region: 375-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-58
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-19
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000056160   Gene: ENSDARG00000053366   Transcript: ENSDART00000056161
Sequence length 547
Comment pep:known chromosome:Zv9:2:42817113:42819940:1 gene:ENSDARG00000053366 transcript:ENSDART00000056161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESTLSLAQDQFNCSLCLELLKDSVAIPCGHSYCMSCISDCWDQDEQKGVYSCPQCRQT
FTPRPALGKNTMLTEVVEKLKKTKLQAARPAQCYSESADVECGVCTGDKNKAIKSCLVCL
NSYCQNHLEQHESFFRGKRHNLMDATGRLQEMICPQHEKLLEFFCRTDQRCVCYLCTMDK
HKNHNTVSATAERTDKQSQLAEMQKTTHQRIEEKQKECVELREAVESYKCSAQAAVEDTE
RIFTELIRFIERNRSGLTQLIRDQEKAAVSGAEGRLERLEQEIDDLRRRDAELEQLSHTD
HHIHFLQSFQSLSAPPGSTDSSSIAVSSRLSFEDVGKSLSLLREKLEHFCRDELEIISDR
VTNINIIPTSEPETIEQFQQYSRQFTLDPNTVNNYLVLSEDNRVIDVIRTYQQYPDHPDR
FNAFLQVLCRESLCGRCYWEVEWSGWVGISVSYKSISRKGRRTDCEFGCNDQSWSLYCSD
SRCSFWHNNQPTKLPVVSSSSRIGVYVDHSAGILSFYSISDTMSLIHRVHTTFTQPLCPG
FWTLDRA
Download sequence
Identical sequences F1QYZ8
ENSDARP00000056160 ENSDARP00000056160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]