SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000056163 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000056163
Domain Number 1 Region: 374-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-56
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-22
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 142-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000013
Family B-box zinc-binding domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000056163   Gene: ENSDARG00000032043   Transcript: ENSDART00000056164
Sequence length 558
Comment pep:novel chromosome:Zv9:2:43804075:43806647:-1 gene:ENSDARG00000032043 transcript:ENSDART00000056164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSISVAQDEFSCSVCLDLLKDPVTIPCGHSYCMSCISGCWDQDEQKRVYSCPQCRQT
FTPRPALGKNTILAEVLEKLKKTKLQAARPAQCYSESADVECDVCTGDKNKAIKSCLVCL
NSYCQNHLEQHESFFRGKKHNLMDATGRLQEMICPQHDKLLEVFCRTDQKCICLLCVVDE
HKNHETVSVAVERIDKQRQLEQARRTHQQRIQRNQKECEELREAVESHKRSAQAAVEDTE
RIFTELIRSIEKSHSVVNQLIRDQEKAAVSGAEGRLKRLKQEIDDLRRRDAELEQLSHTD
HHIHFLQSFQSLSAPTGSTDSSSITVSSRLSFDDVSKSVSRLREKVEHFCREEIEIISGK
VKYTECVFTPEPKTWKELLQYSRRFTLDANTMHTCLSLSEDNRMITETDSDQQYPDHPDR
FDSLLQVLCRESVSGRCYWEVEWSGRGVGISVSYKSISRKGRGDECAFGYNDQSWCLYCF
PSSYCKYSFCHNYTETELPVVSTSSRIGVYVDHSAGTLSFYSGSDTMSLIHRVQTTFAQP
LYPGFRVYGSVELCDTRK
Download sequence
Identical sequences F1Q5D7
ENSDARP00000056163 ENSDARP00000056163 XP_017214148.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]