SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000058356 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000058356
Domain Number 1 Region: 8-95
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.13e-23
Family PWWP domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000058356   Gene: ENSDARG00000019045   Transcript: ENSDART00000058357
Sequence length 757
Comment pep:known chromosome:Zv9:23:45162494:45172672:-1 gene:ENSDARG00000019045 transcript:ENSDART00000058357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGVKMKSDQTTDDFTPGDVVFAKMKGYPFWPARIAEGKAPKNKIPIFFYGTHSTTFLF
PKDIVHYWPNKQKYAQANKRGGFEEGMWEIENDPGVGLRGQKKAALVKRLSESRLKWKNK
KKKKAENQTEVKKPPKSAKDPVSNSDSKAATPHKRETKSESVTLKDDKNTETRPTRSRDS
SAKTSTDKRRTDKVVPARKMTSVKTITTGWRRLPSSVILARRMDAAKTLSAHRKHVLNRK
IISTAKKRIDAVNHRKPSRITRSTADPIEATDDVTAKPLALKRKRKQNDSEVKGDAPISI
PATDISASSTPTGSKRRRLTEPEKKSKDDEKELKENEAQSKEKNEVEQKIEKQNEVEKSN
ADKNKMMEKKNQAEKIVAENETENKGAKKKESEKSDAEKEKSEKKETKKIETERKEARNS
EAESKEPCKNDSEKKEAERIETRKSESEVLVAKNKESEKRETRKSESEMKEARKNESKKQ
EARKSESEKRETRKSESEMKEARKNESEMKEARKSESEKRETRKSESEMIEARKNESEMK
EARKSESERRETKNSEAEIKEAKMKQARKNESEKKEARKSESEKKEAKKSESENKEARGN
ESEKKGARRSESEKKEARQSESEKKEARRSESEKRENRRSESEKKEARRNESEKRETRSE
SEKRETRRNESEKREPRWRESEKKETRRRESEKKETRRSESEKKEPRSESKKKEARRSES
EKKEARRSEFEKKEARRSEFEKKEARMSESDKKEAKR
Download sequence
Identical sequences ENSDARP00000058356 ENSDARP00000058356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]