SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000059975 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000059975
Domain Number 1 Region: 195-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-69
Family Nuclear receptor ligand-binding domain 0.00000582
Further Details:      
 
Domain Number 2 Region: 84-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000059975   Gene: ENSDARG00000040926   Transcript: ENSDART00000059976
Sequence length 428
Comment pep:known chromosome:Zv9:18:23652345:23659078:-1 gene:ENSDARG00000040926 transcript:ENSDART00000059976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVWRGSQDDVAETHGTLSSQTQGGLSLPTPQPGQLGLTASQVAPPTPQTPVQGPPNN
NNNTQSTPTNQTTQSQSEKQQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLT
YTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREVSLFTAAVQRGRMPPTQPHHGQFAL
TNGDPLHCHSYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARMLFSAVEW
ARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVV
AFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALE
EYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSF
NWPYMSIQ
Download sequence
Identical sequences B3DGQ7
ENSDARP00000059975 ENSDARP00000059975 7955.ENSDARP00000059975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]