SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000061114 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000061114
Domain Number 1 Region: 406-858
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-131
Family PIWI domain 0.0055
Further Details:      
 
Domain Number 2 Region: 111-428
Classification Level Classification E-value
Superfamily PAZ domain 7.22e-86
Family PAZ domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000061114   Gene: ENSDARG00000041699   Transcript: ENSDART00000061115
Sequence length 858
Comment pep:known chromosome:Zv9:8:45898382:45911605:1 gene:ENSDARG00000041699 transcript:ENSDART00000061115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRARARSRGRGRGQEPAAPGAQPPVSQEAAKPVVSTPSEGQLVGRGRQKPAPGAMSEE
AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLL
SRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLC
SETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIP
QHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKE
LVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLV
SHVKRLGPSGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINR
LISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMR
GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLR
ALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATK
IALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCV
LQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQS
IKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQA
VRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVG
QSIHKEPNMNLDDFLYYL
Download sequence
Identical sequences Q8UVX0
ENSDARP00000061114 NP_899181.1.45394 ENSDARP00000061114 ENSDARP00000121147 7955.ENSDARP00000061114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]