SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000061524 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000061524
Domain Number 1 Region: 141-426
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-79
Family Nuclear receptor ligand-binding domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 43-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-27
Family Nuclear receptor 0.0000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000061524   Gene: ENSDARG00000029766   Transcript: ENSDART00000061525
Sequence length 430
Comment pep:known chromosome:Zv9:9:9724022:9784029:1 gene:ENSDARG00000029766 transcript:ENSDART00000061525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLYDMCLLQLRMSKEMEELSPLDDSGHGDGSEEETEEDDEPKICQVCGDKSTGYHFNA
MTCEGCKGFFRRAMKRPAQLCCPFQSACVITKSNRRQCQSCRLQKCLSIGMKRELIMSDE
AVEKRRLQIRRKRMQEEPVTLTPQQEAVIQELLNAHKKTFDMTCAHFSQFRPLDRGQKSV
SESIPVTNGSWIDHRPIAEDPVQWVFNSTSLSSSSSSCQSLDKEKKHFKSGSFTSLPHFT
DLTTYMIKNVINFGKTLTMFRALVMEDQISLLKGATFEIILIHFNMFFNEVTGIWECGPL
QYCMDDAFRAGFQHHLLDPMMNFHYTLRKLRLHEEEYVLMQALSLFSPDRPGVTDHKVID
RNQETLALTLKTYIEAKRNGPEKNLLFPKIMGCLTEMRSMNEEYTKQVLKIQDMQPEVSP
LWLEIISKDT
Download sequence
Identical sequences B0V1H8
XP_005167477.1.45394 ENSDARP00000061524 ENSDARP00000061524 ENSDARP00000106185 ENSDARP00000107140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]