SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065384 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065384
Domain Number 1 Region: 332-585
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-62
Family Nuclear receptor ligand-binding domain 0.00000000311
Further Details:      
 
Domain Number 2 Region: 256-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-27
Family Nuclear receptor 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065384   Gene: ENSDARG00000044532   Transcript: ENSDART00000065385
Sequence length 586
Comment pep:known chromosome:Zv9:6:12373999:12378404:1 gene:ENSDARG00000044532 transcript:ENSDART00000065385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGTSPPGASPASQSYSYNTTGEYNCDFLTPEFVKFSMDLTNAEIAVTSSLPSF
STFVDTYNSNYDVKPPCLYQMAHSGDQLSIKVEEIPAHGYHQQQHHQPHQAEESIPHTGA
IYYKPSTPNISQSPSYPTAPHHTWEDTGSLHSFHQNYLATSHIMDQQRKNAMSRLFSFKQ
SPVDTPMPSCQMRFDGSLHVSMGPDTAHRALDSFALPAPPRKQHGVGLSHSLNVGHPLLE
SPVASPQARGSPSSEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNC
PVDKRRRNRCQYCRFQKCLVVGMVKEVVRTASLKGRRGRLPSKPKSPQDIPVSFTPVNLL
NALVRAHIDSNPSMARLDYSKFQTSPEYHSGGDESLHIQQFYDLLTASMSIIRGWAEKIP
GFTELPKCDQELLFESAFLELFVLRLAYRSNLPEDKLIFCNGMVLHKLQCVRGFGEWIDS
IVEFSSNLQSMSLDVSAFSCIAALTIVTERHGLKEPKKAEELQNKLINCLKDQVSCSGEL
SKLLEKLPEVRALCTQGLQRIFYLKLEDLVPTPAIIDKLFHDTLPF
Download sequence
Identical sequences F1QK43
ENSDARP00000065384 ENSDARP00000065384 7955.ENSDARP00000065384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]