SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065584 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065584
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.56e-36
Family Cap-Gly domain 0.00054
Further Details:      
 
Domain Number 2 Region: 118-363
Classification Level Classification E-value
Superfamily L domain-like 9.52e-31
Family Internalin LRR domain 0.058
Further Details:      
 
Domain Number 3 Region: 432-520
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.4e-18
Family Ubiquitin-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065584   Gene: ENSDARG00000044634   Transcript: ENSDART00000065585
Sequence length 521
Comment pep:novel chromosome:Zv9:11:45452521:45468454:-1 gene:ENSDARG00000044634 transcript:ENSDART00000065585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLDEAVGRRVCCDGERGTVRYVGPVPPTAGVWLGVEWDHPERGKHDGSHDGVRYFTCRH
PTGGSFVRPQKASFGVDYVTALKQRYEVEIEEVTAEEMKISSKTVVMVGFENVKKKQSVK
NLTEVGLRRCEVSAPGPENEIRNTTPFVQSLDLSGNLLSSWEVLAAITEQLDSLQELHLS
HNRLSISSAPSSLSSAFSHLRVLSINSCALTWTQVLHCAPMWQQVEELYLADNNITELLR
PEHVLQALTVLDLSNNQIAQETVLEISHLPRLERLNLSSTSLSEIKFSDVPAGKKTTLFP
ALKELLLDDNNISEWRVVNELEKLPSLVYLSCRRNPLLHKEKNLETARQIMIARLGQLEL
LDMRQILSDERRGAELDYCKMFGSAWLRAGGHREAEKNNPNTDFMTEHPRYLTLIQKYGA
PDEGELREQKPFALKNQLLTITFLCPEDLERKPIEKKLPGSMIVQKVKGLLHRLLKLPGV
ELKLTYTCAKMADREIEIDNDLKPLQFYSVEDGDKILVRWS
Download sequence
Identical sequences Q5U378
ENSDARP00000065584 ENSDARP00000065584 ENSDARP00000106604 NP_001035078.2.45394 XP_005155982.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]