SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066248 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066248
Domain Number 1 Region: 429-525
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.29e-24
Family Tudor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 654-746
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.93e-24
Family Tudor domain 0.002
Further Details:      
 
Domain Number 3 Region: 200-295
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.48e-23
Family Tudor domain 0.0023
Further Details:      
 
Domain Number 4 Region: 902-995
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-21
Family Tudor domain 0.0033
Further Details:      
 
Domain Number 5 Region: 76-121
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000119
Family MYND zinc finger 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066248   Gene: ENSDARG00000007465   Transcript: ENSDART00000066249
Sequence length 1176
Comment pep:known chromosome:Zv9:12:31921593:31934556:-1 gene:ENSDARG00000007465 transcript:ENSDART00000066249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAFAQPMMRPNLPLRRPATGPSSLSPRGPAPAIYEERLLASDVLDGPKIDTMRKDISQ
NCGDVLSSPQTAVSMMGQVVKLCNYCSHQGNLRCTRCKKTCYCSVACQTQDWIAHRHVCK
PSIPEVTSEKPKESKAVPYANGLGGTQAKEISVDAQPKRIYRRDLHKKVVSKGSEIKGTV
IDLRNPGMFSIHCQCEEMIESLKKITQQLQKTYCSSFAQEYKPEVGELCAVKFSLDQNWY
RAEIQAVDVARKTAGVFYIDFGNEENVALDHIRPLSENIDAVPPFALQCCIAGVKPLTGS
WTGECCIAVRQLIAGKSLTFTVLDIMNDGDLLAVDSLVSTLGKHVSTFLIDQSYAIKEDV
PVKTQTEHSINSLLTASFENFKRFSGGKNENSEARPPEPLTQGVGDSFTAVVTHLQSPSE
ILCQKLENASIIQQLQMNLRVHCSNTAASDDFRPAPGTVCCSLFSEDNQWYRAKVLAYSS
EDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLK
HLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPA
TSTEIPPLSQPVVEKLEWTGAELPFDGQKVELVISTLKSLDEFYCYNYSKTDEHTLTEMS
FELMKHCESERAPFTPIVGEPCCALFTGDARWYRAMVLEVCGEGKARVCFVDYGNSCEVD
AAHLKAITQSLLKLPFQAIRCWLAGVEPVEGQWKKEAMLRFQALCAGQPLSGKVLSITEK
GYGMELESAGQTVASVLISEHLAKPYGQVRQPPQIQPAKPASQIEDLPSLKPIDQNPSVE
EPLKVSSKGAATTPEDLPVSSGCFPLNWKTLELSCSGTFQPRVAAVISPSLFYIMNPGQV
NVEGLKAVMTDVAKYCSKQPVPNQCHPLPGASCCAQFSGDKNWYRAVVLEVTTKHAHVIY
SDYGNMETVPLSSILPITKELLQHPFQIVRCALTGKEHFPVVWPTEVLELFGIQLSGGVL
ASFQGFDGTSNLLTLTQQSGQSDRDINSIILGALQKGQIKPSSKLPANVNEEKKDVEQKQ
TQPISSNKAVEQTLSTNVEKPALDDQTLPLSVSLKHEEPENMSKTKTAEECTSTPDTVSS
IESSHAAQSCCCQELKQKMDRIEELVLLLVKQVGSR
Download sequence
Identical sequences F1Q7S6
ENSDARP00000066248 ENSDARP00000066248 ENSDARP00000127267 NP_001157500.1.45394 XP_021335785.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]