SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066923 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066923
Domain Number 1 Region: 432-556
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0000489
Further Details:      
 
Domain Number 2 Region: 327-456
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0000404
Further Details:      
 
Domain Number 3 Region: 237-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-17
Family Ypt/Rab-GAP domain of gyp1p 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000066923
Domain Number - Region: 84-137
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0883
Family Skp1 dimerisation domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066923   Gene: ENSDARG00000045510   Transcript: ENSDART00000066924
Sequence length 567
Comment pep:known chromosome:Zv9:4:26923872:27193811:-1 gene:ENSDARG00000045510 transcript:ENSDART00000066924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDGNKKQFWKRNTAKVPGNIQHVYGAQHPPFDPLLHANLMKAGNKPPSASTPGKPKKA
TTFQEFESITSDAWDVGDDDDELLAMAAQNLNIEVVMETANKVIENHSKLQERRQQQMEK
TTEPDEKYGEEVEEEEEEPEEEEEREEVVETTDVSFSSDALPFGDSRLVKSHSEAPIGSP
KEVGIEQAALHRQQSLPHRPVIPLVARMADQNTSGTPAMTEREASRLDKFRQVLAGPNTD
LEELRKLSWSGIPRQVRPITWKLLSGYLPANAERRESTLQRKRQEYFGFIEQYYDSRNDE
HHQDTYRQIHIDIPRMSPESLVLQPKVTEIHIDIPRTNPLIPLFQQASVQEIFERILFIW
AIRHPASGYVQGINDLVTPFFVVYVFEYIEEEVENFNVSSLQEEVLRNIEADSFWCMSKL
LDGIQDNYTFAQPGIQRKVKALEELVSRIDETVHRHMQLYEVEYLQFAFRWMNNLLMREL
PLRCTIRLWDTYQAEPEGFSHFHLYVCAAFLVRWRKEILEEKDFQGLMILLQNLPTMHWG
NEEVSVLLAEAYRLKFAFADAPNHYKR
Download sequence
Identical sequences F1REP0
ENSDARP00000066923 ENSDARP00000066923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]