SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066947 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066947
Domain Number 1 Region: 179-193,351-587
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-59
Family Nuclear receptor ligand-binding domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-30
Family Nuclear receptor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066947   Gene: ENSDARG00000045527   Transcript: ENSDART00000066948
Sequence length 600
Comment pep:known chromosome:Zv9:4:24926699:24945771:-1 gene:ENSDARG00000045527 transcript:ENSDART00000066948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGESPRIQLVSADGGLQIVTEQQLAQKVQIVTAIDQAGAGKQQFILANLDYPNQEKLFI
KQENSPAKVILTSSDGSAVNQLLFASPELSGQQIQFVTDGSDQGSMKPPVEYCVVCGDKA
SGRHYGAVSCEGCKGFFKRSIRKNLVYTCRGSGECVINKHHRNRCQYCRLQRCMALGMKQ
DSVQCERKPVEVSREKPANCAPSIEKIYIRKNLCSPLAAMPTFVSQKESTRPTSLLDSNM
LLNIQQSISKLDNTILIPSSPDQNDSSQGDLGTLANVVTSLGHLNKSREMMDSSTDLSGI
DTMSNDDSVMTDIQREESNDVTRAFDTLTKVLKAEESCGEEVADGAVAVRDDEQTSALLE
LEGPLLSDMHVPFKLMMPLPMPDFLNLNYICESASRLLFLSMHWARSIPAFQALGSENGI
TLMKACWNELFALGLAQCSHIMNVETILTAIINHLQTSLDEEKLSPERVKQVMEHIWRMQ
EFCNSMSRMSPDAYEYAYLKAVVLFSPDHSAVDGTLQIERFQEKAYMELQDYVSKVYPED
TYRLSKLLVRLPALRLMSAAVTEELFFAGLIGNVQIDSIIPYILKMESTDYNSQPISGVE
Download sequence
Identical sequences Q5RH32
ENSDARP00000066947 ENSDARP00000109984 XP_005164874.1.45394 ENSDARP00000066947 7955.ENSDARP00000066947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]