SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000067199 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000067199
Domain Number 1 Region: 72-251
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 
Domain Number 2 Region: 226-337
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000067199   Gene: ENSDARG00000051836   Transcript: ENSDART00000067200
Sequence length 736
Comment pep:known chromosome:Zv9:25:24862435:24898626:1 gene:ENSDARG00000051836 transcript:ENSDART00000067200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKDIDTLIAEERADIIEKYEKGRQEGVHINPWEDGDYSIFKFTDRFGFLHEEELPTPTA
VEEKYKLQEMEREEKWIKMVKKWEKYHNSEKMMKRVYKGIPLKLRGQAWALLLDVEKVKQ
ANFRKYEKMKEQAKRYSTEIKQIDLDVNRTFRNHIMFMERFGVKQQALFHVLAAYSVYNT
EVSYCQGMSQIAAILLMYMNEEDAFWALSQLLTNQKHAMHGFFIPGFPKLHRFQVHHDKI
LSKLLSKLRNHLEKEQMSTGIYTTKWFLQCFIDRTPFTLTLRLWDIYILEGEKVLTAMAY
TLLKLHKKHLLKLSLEDLREFLQERTASSFNMSDDVVIEHLQSSMSELRRMKLDLPPPGK
GDEFPKIPLGEERLIELLSVIQTERVPLPSAAHNNQAASKLQTEDTTSHNQCSNKPIPRI
TSSSSFSQQSQLPSSSSLSQPPPEDSDRTQESAPVQAQSQVLQPEPTSRSTEALSLKDEC
VSRPLSGVSEDWPPPYQPPITDSSSIVSFNLPELPPPPLPYTDQGVELPEDPFYIPPLPP
PPPITQPLDLIVEDPSSSPSLYRSYRQLSKFPINLYVPPSSGDRRPSNTSYYDNISEEED
QSVDRLLEMAATLPQNPMLGVKNTAYTLPSEDAMSLSLPPPSMFFYTPDSSPLPPPPLCT
EESSNWVTPDCIFPQPPVGFEDQPFLLSSVPCSQLVMNQNEQDRGQSQPPRLPPKKLKTT
MPPPVHSDYRMHVPSH
Download sequence
Identical sequences F1R1B6
ENSDARP00000067199 ENSDARP00000118665 ENSDARP00000067199 XP_005170766.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]