SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000067975 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000067975
Domain Number 1 Region: 355-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-61
Family SPRY domain 0.000014
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 6.36e-18
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 3 Region: 135-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000565
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000067975   Gene: ENSDARG00000007199   Transcript: ENSDART00000073484
Sequence length 544
Comment pep:known chromosome:Zv9:7:26869534:26876624:1 gene:ENSDARG00000007199 transcript:ENSDART00000073484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVMTSFSSSLSDESFQCHICLEVFTDPVTTSCGHNFCNICIEACWNSEQLFLCPICKKDF
ENKPELKINTSFKKVVDCFKVHQQPKKLQQQTKTIFCDVCSEYAVKSCLQCVTSFCETHL
EIHKTAPRLKKHKLINAVENLEDYICSKHEKPLEMFCRDDQTCLCLFCTETEHKHHKAVP
IEEESGHRKVYLEKTQAEIQVMMKNKNNIINTISSQYAINNQSNTERKKAHHVELFSDLM
CSIERCQGELLEVMEQKQKAAEKQAEELIIALKQEIKELKRRNTELEELSHTEDHLHLLQ
VYSSVCGPPQVNTWTNISISNTDLKNTTTLEKALASLKETVNKELKKIHDIIDLRTIQKL
YAVDVILDPNTAYPKLVLSKNGKQVSHGGTWTDVPNNPERFDTSACVLGKDGFSCGRFYF
EVQVSDKAEWDLGMARKSINRKGKIKVCPECGFWSIWKRNGNEYVANESSPVWLSLKDKP
QKVGVFVDYDEGLVSFYNVETEALIYSFTGQSFIEKIYPFFSPCNKRGNTNSKPLIISTI
NYPN
Download sequence
Identical sequences ENSDARP00000067975 ENSDARP00000067975 7955.ENSDARP00000067975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]