SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000068179 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000068179
Domain Number 1 Region: 384-562
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-63
Family SPRY domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 14-84
Classification Level Classification E-value
Superfamily RING/U-box 8.62e-21
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 168-223
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000656
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000068179   Gene: ENSDARG00000051965   Transcript: ENSDART00000073689
Sequence length 565
Comment pep:known chromosome:Zv9:1:45519443:45531891:1 gene:ENSDARG00000051965 transcript:ENSDART00000073689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRCTMSFPGEFLSEEQFTCSICLDIFTNPVSTPCGHSFCSSCISSYWEGQGKTCFCPLCK
ESFRKRPELHVNHTLKEITEQFKRMAETTVSVPKTATTDSPPNPFSAQKPGVQQRPVELP
KGLFQEMKTRMQRSSSTSSSNEPLASGDPQSLPNVKMPRRNFSVTAAGSNGPQCPNHGYS
LELLCKTDLMCICAVCAESEHYGHTVTEAKREMNIRKSQLRILEVELQGLITVRERKIEE
IQTSLAEIQVNAEREKAGTISMFAELMKSVEKSQAELLEVVEMGQRAAELRSQAFIREVQ
TEISDLKNRCSTINQLTQSQDHLTFFKTFSAHTSLPVMKSWAEVALTPDPTAGVVLRNVS
QMVEEVRQGLRRLSEICVWRAPGFAMDVTLDKDSAHPRLVISEDGKQVLCSDRYQNVPDT
LERFDRVVCVLGRQGINSGCHYWEVLVSDKTDWDLGIAARTINRKGKIAANPANGFWFLS
LRDKQDYVFRTEPSTPIIVNPKPQRITVSVDYERGQLSFYNADTKTLIFTYTDSFSETLY
PFFSPCTNKSGKNEAPLIICPPFVA
Download sequence
Identical sequences ENSDARP00000068179 ENSDARP00000068179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]