SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069037 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000069037
Domain Number 1 Region: 142-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-71
Family Nuclear receptor ligand-binding domain 0.000000000984
Further Details:      
 
Domain Number 2 Region: 32-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-28
Family Nuclear receptor 0.00000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069037   Gene: ENSDARG00000052654   Transcript: ENSDART00000074549
Sequence length 391
Comment pep:known chromosome:Zv9:12:23154548:23189395:-1 gene:ENSDARG00000052654 transcript:ENSDART00000074549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWLDGPKRKRKNSQCSVKSMSGYIPSYLEKDEPCVVCGDKATGYHYRCITCEGCKGFFRR
TIQKNLHPSYSCKYDGCCIIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRRLIE
ENREKRKKEEMVKTLQNRPEPTSSEWELIRVVTEAHRHTNAQGSHWKQKRKFLPEDIGQS
PVAPTSDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM
SLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLAQFNLDDTEVALL
QAVLLMSSDRTGLTCVEKIEKCQEMYLLAFEHYINYRKHNIPHFWPKLLMKVTDLRMIGA
CHASRFLHMKVECPTELFPPLFLEVFEDQDV
Download sequence
Identical sequences ENSDARP00000069037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]