SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069169 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000069169
Domain Number 1 Region: 124-295
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 2 Region: 273-391
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.44e-30
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 935-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 862-873,904-941
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000117
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069169   Gene: ENSDARG00000052766   Transcript: ENSDART00000074683
Sequence length 996
Comment pep:known chromosome:Zv9:1:45691637:45760950:1 gene:ENSDARG00000052766 transcript:ENSDART00000074683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPSSSPEREGGMAGSVQLEDLNSPAGLEIDPPFIGSPVLSPDSSSHDAALSAPAASPA
DSENLSPDELELLAKLEEQNRLLEADSKSMRSMSGSRRNSGSSLVSSSSASSNLSQLEED
TWILWGRIVNEWDEWRRKKDKLLKELIRKGIPHHFRAIVWQLLCNATDMPVKNQYSELLK
MSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGL
LLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEHLLQEQLPELNVHFRSQS
FHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDME
GMSQHFQKVIPHQFDSCPDKLILRAYQVKYNPKRMKKLEKEYTTIKNKEMEEQIEIKRLR
TENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVIKRELAVVRQQCHTASESLE
KAQDTIRELQQHKYTEEFVSGLQTQLEQSRLQEAELLGALKEMQDKVLDLEKRNSSLPDE
INVAQLQEELKLVKLREQETLRSFREMQEAVTDLNHCWQHHTSRGGGGGGGGHWKESPKK
NAMNELQDKLMSLRLREAQGQAELKEVKLKNLQLESQNQINGKLLGRHEQESTSLQERLQ
NALSHNKTLQSQLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIADLEIQKE
EGLIQGQLNHSDSRQYITELRQQIAELKSEIRQLRGQPSKFQNNGSGVYQDLCLESPASA
EGDYLSSDEDPLQSLPVSSLYPNHSSPRLDSQGSTDSDDPAGFRYGPPPSPVQWLPVNSR
DIADIHSLSSRDGALDCPIVSPKYCSLCGKVFSSLSRLESHVFRAHGGHHGRALVFRDSK
DPVMPCRIKERTFECKECGKVFKRSSTLSTHLLIHSDTRPYPCLYCGKRFHQKSDMKKHT
FIHTGEKPHVCKVCGKAFSQSSNLITHSRKHYRPYS
Download sequence
Identical sequences ENSDARP00000069169 ENSDARP00000069169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]