SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070261 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070261
Domain Number 1 Region: 25-148
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.45e-23
Family Hormone receptor domain 0.00038
Further Details:      
 
Domain Number 2 Region: 134-415
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000119
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070261   Gene: ENSDARG00000053708   Transcript: ENSDART00000075780
Sequence length 453
Comment pep:known chromosome:Zv9:6:32580713:32658211:1 gene:ENSDARG00000053708 transcript:ENSDART00000075780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFFRTWSTVRLVTVLLSLGIHKSTWKAVETIHPACALVAAHMKAQEQCNATQRQESQNR
NNVTGCPTEWDEFWCWSGAEVGQVVNISCSEVSQLFVNHGFIFRNCTKDGWTEVYPSYEN
ACEIVEDVESETETTYYATFRQVYTAGYATSLISLITAIFVFTVFRKFHCTRNYIHINLF
ASFILRASAIFIKDAVLFADENLDHCFMSTTSCKAAVAFFQFSILANYFWLLVEGMYLQT
LLALTFVSQKKYFWWYILIGWGLPTLILTIWVLARNFFDNNGCWDDTDVAYFWWIIKGPI
TVSLLINFLIFINVIRILVQKLKSPGMGGGDTNHFMRLAKSTLFLIPLFGMHYMVFAFLP
ENTGENARHFLELGLGPFQGFVVALLYCFLNGEVQAELKKRLWKWQTQSYLRYSKRRRTL
FTESSTVTQISVLEKSSPKELPLTESNNSVSTV
Download sequence
Identical sequences E7FF79
ENSDARP00000070261 ENSDARP00000070261 XP_001331921.5.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]