SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070793 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070793
Domain Number 1 Region: 367-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-65
Family SPRY domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 31-102
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 154-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.73e-17
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070793   Gene: ENSDARG00000054184   Transcript: ENSDART00000076318
Sequence length 556
Comment pep:known chromosome:Zv9:7:16970942:16980218:-1 gene:ENSDARG00000054184 transcript:ENSDART00000076318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSLPTLSKRPAETRRCSKDEPPSLSSSMSPLFEELQCSVCLDVFTDPVSTPCGHNFCK
SCLNSSWENSQVCSCPLCRERFSDRPDLKINTGLRQLGQLFKERLTLRISGVLCDICEGR
KMKALKSCLTCQTSYCETHLEPHLRVPNFKKHKLMEPVKNIKDYICQKHERPLELFCRDD
QMCVCVFCTDGDHKTHNTVPLEEESKEKKIQMIKTQTDVQQMIQDRVKKIQDIEHSADLR
KKSTEREKASRLQLFSDLMRSIERCQAELLEMMEEKQKAAEKQDEELIQELQQEINELKM
RSSDLDHLSSTEDHLQLLQIYPSICSPPNLKNWPEISMNTDVSLETLRRALTQLQETLDQ
KLSQTVLKRMQHYAVDVTLDPDTANPFLILTDDGKQVTHGDTNQNLPNNPQRYDQCNTVL
GKEGFSSKRFYFEVQVKEKTKWDLGVASESVKRKGKITLSPQHGYWAVGLRNSDVYWAFD
APAVRLSVREKPQKVGVFVDYDDGLVSFYDVESRSHIYSFTGQSFTEKLYPLFSPCINDE
GKNSAPLIISAVKSIE
Download sequence
Identical sequences F1QZB6
ENSDARP00000070793 ENSDARP00000070793 XP_021333051.1.45394 7955.ENSDARP00000070793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]