SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070972 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070972
Domain Number 1 Region: 197-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.09e-78
Family Nuclear receptor ligand-binding domain 0.00000000169
Further Details:      
 
Domain Number 2 Region: 96-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070972   Gene: ENSDARG00000054323   Transcript: ENSDART00000076500
Sequence length 461
Comment pep:known chromosome:Zv9:25:2169926:2194705:1 gene:ENSDARG00000054323 transcript:ENSDART00000076500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASMVDMENRYRPPSPLDDSVLDSALFVRGMEELRDISQSMDEDALSSFEMTENQSGLGSG
SESSTVLDALTPASSPSSGVYGCPVGQDEFTSTSLNLECRVCSDRASGYHYGVHACEGCK
GFFRRTIRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPQSEKLR
LKAEILTGERDVKDDQKTLAKQIYEAYVKNFNMNKSKARTILTGKTSTPPFVIHDMETLQ
LAEQTFVAKMMGSCGGLLNKDPEVRIFHCCQCTSVETVTELTEFAKSVPGFSNLDLNDQV
TLLKYGVHEALFAMLASCMNKDGLLVAYGSGFITREFLKSLRRPFSDMMEPKFQFAMKFN
SLELDDSDLALFVAAIICCGDRPGLVNVPHIERMQESIVNVLHLHLKSNHPDHGFLFPKL
LQKLVDLRQLVTEHAQLIQEIKKTEDTSLHPLLQEIYRDMY
Download sequence
Identical sequences ENSDARP00000070972 ENSDARP00000070972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]