SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072528 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072528
Domain Number 1 Region: 1942-2100
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.76e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000372
Further Details:      
 
Domain Number 2 Region: 345-526
Classification Level Classification E-value
Superfamily Cupredoxins 5.73e-51
Family Multidomain cupredoxins 0.0000121
Further Details:      
 
Domain Number 3 Region: 1446-1624
Classification Level Classification E-value
Superfamily Cupredoxins 4.81e-47
Family Multidomain cupredoxins 0.0000493
Further Details:      
 
Domain Number 4 Region: 26-195
Classification Level Classification E-value
Superfamily Cupredoxins 4.29e-46
Family Multidomain cupredoxins 0.00000764
Further Details:      
 
Domain Number 5 Region: 1774-1941
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000371
Further Details:      
 
Domain Number 6 Region: 535-673
Classification Level Classification E-value
Superfamily Cupredoxins 1.65e-38
Family Multidomain cupredoxins 0.00012
Further Details:      
 
Domain Number 7 Region: 1630-1772
Classification Level Classification E-value
Superfamily Cupredoxins 1.12e-35
Family Multidomain cupredoxins 0.0000445
Further Details:      
 
Domain Number 8 Region: 199-326
Classification Level Classification E-value
Superfamily Cupredoxins 3.01e-32
Family Multidomain cupredoxins 0.0000238
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000072528
Domain Number - Region: 1049-1189
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0768
Family Galacturonase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072528   Gene: ENSDARG00000055705   Transcript: ENSDART00000078065
Sequence length 2101
Comment pep:known chromosome:Zv9:9:35098310:35119300:1 gene:ENSDARG00000055705 transcript:ENSDART00000078065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRSWPGALHGLALLAFLCHCATAVERHYYIAAVNINWDYTSGQQRTGQSYKKVVYREY
NEGFKQPKAHPLSSGLLGPTLRGQEGDTIIVTFRNMADHPCSLHPHGIAYGKQSEGSLYF
DNTSLLEKNDDVIQPGEEHTYQWDVTSDVTPTAADPPCITYTYLSHFDIVRDYNTGLIGP
MLICKKGTLDDSGNQIHFHQESVLLFGVFDENKSWYSTGDSPQPLNVKYTINGYTNGSVP
DLDICAHSKVSWHLLGMSSEPELFSVHFNGQVLLHDGHKTSAVGIISGTATSASMTGVHP
GRWLVSSHISKHLEAGLHGYLNIRKCDEYTAPKRRLTIEQKKESQEWTYYMAAEEVIWDY
APNMPENMDGDFRSKYLKQGPQRIGKKYKKAVFTQYKDGMFKERAEDKQRKRELGILGPV
IRAQIRDIIKIVFKNKASRPYSIYPHGLTIDKAAEGASYPQGGNQTYSVQPGETYTYTWS
VTEEDVPTDSDPRCLTRMYHSAVDAPRDIASGLVGPLLICKSQSLNKKNVQLKADKEQHA
MFTVFDENKSWYQDENINTYCSDPKKVKKDDPEFYKSNVMHTINGYVYESGQELGFCHGE
IVTWHVSSVGEQDYIQTATFYGHTFELKNREEDILSLFPMTGETITMNMVNIGIWLLASL
NSHDSTKGMRVKFKDLECFRDYVIEYDYEDGKFTAWKPPTINEIKKEEPVRARPDVVDEY
SDLFAETLNLRTFNNVKDEVEIIDLTFLDQDDGLLPIVEEKSLGSSNENLHNATLQSFIE
THGLLMEEGDLDKGESSNKVLNDSTDKALLETTTTFDSNRVVALNNETDSIILDFPIVER
KVRSAPSKPMNEPESVTMNFKTTEHINSSLERINAIYSPITETNINTMTETHTDFSITPF
DGSTGEMNFTLEDDTALLNSSESEPLQSNQNSENRIAFQEELNAKDGTDVDSNNSVKNQI
FKYNVPSGDTLSNSSKIQVEEDFVLLDSSYFSEMSTTMEYDVSQKDTVKGESKETAQSQE
LSSTKKTYSGEIILESLPDITSAFNLNSSSVLRNNSLESNESSNETLFMSSNATFSDSTN
ATSSDSSTATFADFSNTTFSNATFSDFSNRISQMSDSSNATLSDSSNATLSDSSNATLSD
SSNATLSDSSNATLSNSSNATFSDSSNKTFSDSSNATLFGVSYSSNTTLSDFSLESEMTE
YILSSANDTIKSHSEVVSNTSQLSSSESTENISLLYGSLNASSMKNDSESESEEEVVIYL
NKNHSEAILTSHLDQKEEHWGYESKHELVHKELPDHMNKYVKDKSAANSNKPKIEKEKKK
VYQRVKPKKGYGMKTKKSKDYKPQPRSSFSPRGFGPSVLTPRGSRPVSSEDELTEKPIVI
GVPRRDFNDYELYIPKQDQEADFDGLLDHPEEYEYVEYKDPYSKTADVQALDATSQHLLK
MAGDKNTRTYFISVEEEEWDYAGYGQRRLDKTAQNERPTVFRKVVFRRYLDSTFSIRDIR
GEMDEHLGILGPLIKAEVDQTVMVFFRNRASRPYSLHANGVKYLKQMEGLSYDDESPYWY
KQDDAVPPNGTFTYMWTINPKSGPQNNESDCRTWTYYSAVNPERDINSGLIGPLLVCRKG
TLDKKPEDRREFVLLFMTFDENKSWLYEENRQRIERKNRRVVMDPNFQDNLKFDAINGII
YSLKGLRMYTNQLAKWHLINMGSPKDLHSVHFHGQTFINKELKDHRQGVYPLLPGGFATL
EMLPSKPGLWQLESEVGLSQQRGMQTLFLVLDNVCDHPLGLISGTVQDEQITASDTRGQW
YPHLARLHNTGKYNAWSTSSEPGQYLQVDFQRPVVISKVATQGAKQFLTHNFVLNYTISY
STDKKKWIYYKGDSDAVRKANIHKTNVFFNARQTFEGNAEAYETKENIFFPPLIGRYVRL
HPLHSYNFPTVRLEYYGCELDGCSVPLGMEKGLIDDSKITASSVASNWYSGQWHPWYARL
NKQGTANAWQAKNNDIQPWIQVELKEVKKITGIVTQGAKSMGNEMFVRSYILEYSEDGRR
WMKYTDDDDYEQKLFQGNTDNNGQIKNYIYPPIFSRFIRIIPKQWQKSVTMRIELLGCDF
E
Download sequence
Identical sequences Q90X47
ENSDARP00000072528 7955.ENSDARP00000072528 ENSDARP00000072528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]