SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072712 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072712
Domain Number 1 Region: 327-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-56
Family Nuclear receptor ligand-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 254-331
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-28
Family Nuclear receptor 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072712   Gene: ENSDARG00000055854   Transcript: ENSDART00000078250
Sequence length 594
Comment pep:known chromosome:Zv9:16:29573622:29597577:1 gene:ENSDARG00000055854 transcript:ENSDART00000078250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGPPPHGSSYSAQSFGYHGDYSADLMATDYTKCELSGGEISAAAATTSLPSFN
VFVEGGFEPKPSCLYQLPPQRPIIKKEEESFPPMAPSDEAIPGSSMYFKQSPPSTPPTPL
HPGPPSSSFLWDEHSLPPVPQPCLIEGPLKSPRFPHFYEQTVPPSTSGYDTAIGLPLRPE
RSPSSSSSSSHVPPNMDTHAHSHVHSHTHSNMYPINMGKPGGLAFRSLGMGHCPPLLGES
LPSPPNRTSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLASKNCPVD
KRRRNRCQYCRFQKCLSVGMVKEVVRTDNLKGRRGRLPSKPKSPLQPEPSPPSPPLSLLN
ALVRAYSQSTPRELDYSQVTDAVEPVGLSESQQIQMFYRVLTGSMEVTRCWAERLPGFSE
LHHDDQNMLIDSAFLELFVLRLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDF
SAHLQELNLDMPAFSCLCALVLLTEQCPGLKEPKKVEELQSKLICCLRDHLNSINAGGVA
STGKAPPPVGAVLGLRAELRSQRTQGLQRIFYLKLEDLVPPPPLIDRFLDTLPY
Download sequence
Identical sequences F1R8N1
7955.ENSDARP00000072712 ENSDARP00000072712 ENSDARP00000072712 NP_001166100.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]