SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073251 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073251
Domain Number 1 Region: 753-974
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.04e-18
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 
Domain Number 2 Region: 36-112
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000187
Family Tudor domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000073251
Domain Number - Region: 87-190
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00471
Family Staphylococcal nuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073251   Gene: ENSDARG00000056339   Transcript: ENSDART00000078790
Sequence length 977
Comment pep:known chromosome:Zv9:16:23576959:23624442:-1 gene:ENSDARG00000056339 transcript:ENSDART00000078790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSEIQSEKMELVVVTYVVDAITFWAQNVTDKINEKINAMLTEKCPTAPILMGRPSSHK
VYAARFSEDKCWYRCTVQQQTEDKFYILYIDFGNMEIVSRSDLVELPEELQTAGLAKKYR
FWGIHASSEQDSALHPQGKSFLHNMIHGKKLRVHKKSVCFDGTILVEAFQGNLDIGEELL
KFKLAKVSLPGNKENSIPSVKLQEHTGLWPSRSTSGELETLGSTLGSMPKLRPIFSVQKP
PEFFREQKSAIDLQHVEKPNIDQEPLTEIKSSTTDADEQQLCSQDTEQVHNETESELQSM
REVIDEKHMEEIKKLKEEGSAVQLHVLLLGQQLKEAKLELQTLKESHEKTKEIGNNHPTT
VANRISQLAKKVDAVRKLRERNPCSTDEEHLLQSITIIKNYRISMPMSSERLELAWKAYD
QALENLKHCQTITEIQPLVNSRNEARGALLLTVDDFLQEVDKFPVRERANRLKEVASSLT
AVFSSVMLPEQIDEYAFEKFCEWKRHKQQRIKTVQKATDEALLALSGWASSFSKFLCLME
KTSVTEKDVSEGVDEILMNADNALSEELDTEFSKQNNQDRKIVFNAFLKAMQDIQKEQSL
LEDIKKMYDLNSKFKQEVQQWQSSPPKADELFVVKKRIRNLRSQLRWKLVEVSCLEEAEE
LDLPEILKKKEEIAETRNALFQEISQEKKQYIMLCELVKKSFPELPVIYPDADINDYMSS
AGLLVKSLDRDMFDAEPMKELSGKRPLLSTDFQGQKVVLKCYAVDRESEVKVLEQAAEYH
RVQQNNPATTVPLLALFCGKSDPLAYVMVPDYSIGSLRAIQKSSPLFSCEIRNVMKGVAL
GLQGLHAASVTHASLHPNNVFVIGRERGIVGDYDFTKAPEQRVCDSGMIAGFISLVAPEV
KQGQPPSPSSDMYAFGGIMLWLHFQDFNGALDTQNVDFTGLEMNVKLQALLSKLLLSSTR
LSASEALKQDYFISDDM
Download sequence
Identical sequences ENSDARP00000073251 ENSDARP00000073251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]