SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074004 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074004
Domain Number 1 Region: 198-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-40
Family Dual specificity phosphatase-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 374-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-32
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 3 Region: 57-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000004
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074004   Gene: ENSDARG00000056985   Transcript: ENSDART00000079549
Sequence length 511
Comment pep:known chromosome:Zv9:10:25121730:25139152:1 gene:ENSDARG00000056985 transcript:ENSDART00000079549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVHFNPGLDSKEVNGNSVKEEAEVQIDDGKEETKDPDTMYHQVRKKITPFVMSFGFRV
FGLVLIILDIIMVIVDLSLSEKSRDVGGALETVSLVISFFFLIDVLLRVYVEGFKVYFSS
KLNIVDACIVVITLVVTMIYAFSDFSGASLIPRVVTFLRSLRILILVRIFRLASQKRELE
KVTRRMVSENKRRYQKDGFDLDLTYVTERVIAMSFPSSGKQALYRNPIREVVRFLDTKHM
DHYKVFNLCSEKGYDPKFFHYRVERVMIDDHNVPSLDDMLRYTACVRDWMAADSRNVIAI
HCKGGKGRTGTMVCTWLIDSDQFESAQESLDYFGERRTDKSMSSKFQGVETPSQSRYVGY
YEIMKNQYNRQLPPRKSLKIKSIRIHSIAGVGKGNGSDLKLKIIVKHELVFQCVCAKQHN
CTVFPDTGSNAVVISLQDGPIVTGDVKVMFESSAGLPKGYEDCPFYFWFNTSFVENYRLF
LSREELDNPHKPKTWDIYKEDFGVTLSFTEP
Download sequence
Identical sequences F1QG29
XP_005155316.1.45394 XP_005155317.1.45394 ENSDARP00000074004 7955.ENSDARP00000074004 ENSDARP00000074004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]