SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000076740 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000076740
Domain Number 1 Region: 373-560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-50
Family SPRY domain 0.00054
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-21
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 136-188
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000748
Family B-box zinc-binding domain 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000076740
Domain Number - Region: 209-275
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0628
Family Apolipophorin-III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000076740   Gene: ENSDARG00000039852   Transcript: ENSDART00000082304
Sequence length 562
Comment pep:known chromosome:Zv9:2:878904:888438:-1 gene:ENSDARG00000039852 transcript:ENSDART00000082304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGVSVDQFSCPVCLDVMKDPVTIPCGHSYCMSCITDCWNQEELKNTEKIYSCPQCRH
TFSPRPALFKNIVFAEMMEKLQKTKVCAAAGAGDVQCDVCRKHRAVQSCLVCLNSYCQTH
FERHEEFHPGKRHTVIEATGKLQDMICKKHHKLLEVFCRTDQICVCMLCMVDEHRNHDTV
STALQRTEKETELKELQVKCQQRILQKQKEQQQLREAVTSHKRSANAAVQDCQRICSELV
SSIERSCAELKKQIRDQEKTAVRKAEGVLKKLQEEIDDLRRRDAEMKQLTETQDNIHFLQ
SFQALSVLLGESTDHTALEMTVSAHPPFHYVKESLSAMREKLDDFCRNELKTISDRVKCV
EIIPSPSPEPQSREQFLHYSYQLKLDLNSICRALGLSEGNTEIFQGDTWYEYPDYPDRFD
YWDQVLCTESVCGRSYWEIELSETGSVDIAVSYKNIRRKGDYNRRECLFGNNDHSWSLGF
SRYPDFSRCTFTHNSTVTALPFIPKSRKIGVYVDHRAGTLSFYSVSDKMSLIHRVRTTFT
QPLYPGFRVIYGTCMKLCDLSK
Download sequence
Identical sequences E7FBJ9
XP_005170820.1.45394 ENSDARP00000076740 ENSDARP00000076740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]