SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000076910 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000076910
Domain Number 1 Region: 343-572
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-68
Family Nuclear receptor ligand-binding domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 116-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000076910   Gene: ENSDARG00000059370   Transcript: ENSDART00000082475
Sequence length 576
Comment pep:known chromosome:Zv9:11:1908125:1932556:-1 gene:ENSDARG00000059370 transcript:ENSDART00000082475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPGGSVILYAGSTGSASPSPGSPSSGYQTQSPSSQPSSPEEVSFTELGALKKHSSGGN
GGNKLVFQFPEVSSANTVNAVTPTVTSSGQNSYSHPMVGRRPTGFTGTFTKTGGMVLLCK
VCGDIASGFHYGVHACEGCKGFFRRSIQQNIHYKMCVKNENCLIMRMNRNRCQHCRFKKC
LSVGMSRDAVRFGRIPKREKQRLLDEMQSYMNSLNESASMDIGCTTPTETPSSPEDGQSE
ESIGVISQAYRNIFVNGEKLQVKVDQENNVNNNNNPSSFRHHPMQESGYVQSHPQPNISA
QEHSVHSTTSCLAQSRCPVANQNNKPTSQVLDNGHYNFPQSSSPSQGTTPTQSYPTKHNS
YSTQTQSCPWRLSPGAKVLACPLNACPVSSASHSSQQVWESFSQCFTPAVKEVVEFAKSI
PGFQALSQHDQVMLLKAGTFQVLMVRFCSLFNAKERTVTFLNGQTYPLSYLRVLGMGNLL
DAMFEFSEKLGSMGLEADEMALFMAVVLVSADRSGISDMGAVEQLQEDLIGALRALITRR
RPEDSSLFPKLLLRLPDLRTLNNQHSEKLLAFHIDP
Download sequence
Identical sequences X1WC37
ENSDARP00000076910 ENSDARP00000076910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]