SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078348 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078348
Domain Number 1 Region: 218-246,276-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-55
Family Voltage-gated potassium channels 0.00062
Further Details:      
 
Domain Number 2 Region: 93-189
Classification Level Classification E-value
Superfamily POZ domain 2.88e-27
Family Tetramerization domain of potassium channels 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078348   Gene: ENSDARG00000059935   Transcript: ENSDART00000083913
Sequence length 532
Comment pep:known chromosome:Zv9:6:49408463:49410169:1 gene:ENSDARG00000059935 transcript:ENSDART00000083913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPREGREAMEVPLVNFENLDDIGRGRQPRHSLTSPPTLSKKGTSSCNSLISNWKVLMSS
EGSPNEALLGKVSKDCCEDYFTEKEKFQEGEQKVVINVSGMMYETTLKTLNQFPDTLLGD
PMKRIDYFDPMRNEYFFDRNRPSFDGILYFYQSGGKIRRPANVPLDVFADEMVFYQLGHE
VMEQFREDEGFIKDPEPQLPTSELHRQFWLLFEYPESSSAARSVALVSVFVITISICIFC
LETLPEFRDEREFVPAFVNLTRDANGTLLSRPRPHKISAFTDPFFVVETVCIIWFCFELG
VRFVVCPSKSEFFSNIMNVIDIVSIMPYFITVITELMATQEEEEEDPTANQNMSLATLRV
IRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAIYFAEVDEPD
TQFVSIPEGFWWAVVTMTTVGYGDMCPITLGGKMVGILCAIAGVLTIALPVPVIVSNFNY
FYHRETEQGEKNMIDAAAEAAANQKNSSEEKYESNYSLDKSNGNWQTGKNGI
Download sequence
Identical sequences ENSDARP00000078348 ENSDARP00000078348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]