SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000079481 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000079481
Domain Number 1 Region: 820-932
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000331
Family PWWP domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000079481   Gene: ENSDARG00000060395   Transcript: ENSDART00000085046
Sequence length 1140
Comment pep:known chromosome:Zv9:2:37170128:37182556:-1 gene:ENSDARG00000060395 transcript:ENSDART00000085046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMSSSDESLKRQRNPHRTCRTDSTQVNEPVSGGTESITHNKRTTAPQDLILVKSCGR
RATENKPQAANQNAPPCLRKSRRQVTNINGCVSKKSHQPEQVLPRKIATPKYQIKTAYKG
RRKKNVEASEKKVAASKAKLDVLDNLCSEQHLSSQKPKRTHHQNSKRTQNHQTPSDVSTG
VYTCTTLSPCRCKEDSCCHTNRPQAPLQDRLQFTSLLSSTSNSDLKSLSPQTGQNSCVPH
SEPDVLKSSLEKRPPTDASPSPQRARGRPKGNNNKVQEDPSSFLPLKHSRESTECPVEYP
KRFLHSSSDLQCLSPQTAENSCAPNNHQNARKSRLKKRPPADALPSPQRARGRPKRNNNK
VQEDPSSSSPVKHSRESTECPVEYPKRFLHSSSDLQCLSPQTAENSCAPNNHQNARKSRL
KKRPPADALPSPQRARGRPKGSKNKKVQERPSASPSEKYSRKHEMPLVESCSQKHLSSPW
NSHLQPLKPKTDDNSFAPYNDPNARESQQEKRPPADASSSTPSRPRAGPKGSTTKKIQKK
SSISPPVKCSRKFTECLAASHTPKQKRLQSSPLLSSTPSSHHLPLIPLRADNNPAPNATK
SRLQKRPPADASPSTPQRPRGRPKGSMNKKVQEGASVSPPVKRSRKFTECLAESHTPKQK
RLKSSPLLSSTPSSHLQPLTSKREDNNPAPNATKSRLEKRPPADTSPSTPQRTRGRSKGS
TNKKVQEGASVSPPVKRSRKSTEFPAEMQTLSSPCSENQEPEPNESDQTMSSDLSIELSL
HEDPHLLNHSLFMQEEKDDQDDDDDDEELPSFLGQDSKKPLSISEGLCVWCKMWKYPYWP
AVVKSVNRKNKKASIIFIDCDLSDQKRAKKGFTVSLRNLKPFDCEDYEKLVDMAKEKYGS
AITWSVELISDYRIRIGCGSFSGSFIEYCAADISCPVRRKYSEGKSVLTFPSQEILGEKC
DISENSAEDICAEDQDELLSQKRNLPDRAKAARTRANEQLVDFIIRGKVENHLLAIISES
SAWMQALQKPFRQVVCPVLYLEDEGQVDKVYQYLHDLCETAPQINTSPENVQVVRVRLIL
DVLLPKAIIYAIAGVHNLSLEKAEEKYHKGPRFSNRERQEFDMMIERQMKLKEITQRHRR
Download sequence
Identical sequences ENSDARP00000079481 ENSDARP00000079481 XP_001346027.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]