SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080303 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080303
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-70
Family BAR domain 0.00000000247
Further Details:      
 
Domain Number 2 Region: 476-630
Classification Level Classification E-value
Superfamily PH domain-like 9.72e-24
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-23
Family Pleckstrin-homology domain (PH domain) 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080303   Gene: ENSDARG00000060734   Transcript: ENSDART00000085868
Sequence length 706
Comment pep:known chromosome:Zv9:11:43680161:43707068:1 gene:ENSDARG00000060734 transcript:ENSDART00000085868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIDKLPIEETLEDSPQTRSLLGVFEEDAAAISSYFNQLFKAMQRIYDAQNELSAATHL
TSKLLKDYEKQRFPLGGDDEVMSSTLQQFAKVIDELSSCHAVLSTQLADAMMFPITQFQE
RDLREILILKEVFQLASDDHDAAVHRYSRLSKRKENEKVKNEVMEDVYTSRKKQHETTMH
YFASLNMLQYKKKIALLEPLLGYMQAQISFFKLGSENLTQQWEDFLTNIGTSVQNVRREM
DSDAEAMEQTIQDLKEASDPLYMPDPDPNRIPVNRNLTRKAGYLNTRNKTGLVSSSWERQ
YFFTQGGNLMSQSRGAVAGGLVMDIDNCSVMAVDCEDRRFCFQITAFDGKKAAVLQADSR
KDCEEWIATINNISKRIYLSENPEEIAARVNQSALEAVTPSPSFQQRHESFRPNTQGKVK
ASRSGSQCSVGSESPALSSLSLDSLVAPDTPIQFDIISPVSEEHTSQTKSSAQGRTNPFG
ESGGSQSEESEDSILHQLFIVRFLGSMEVKATESSDVIYETMRQILAARAIHNIFRMTES
HLLVTCECLKLIDPQTQVTRLRFPLSSVVLCASHQENSVCLFVLQTAGGRADGQPVTVCY
IFESNNDGEKICDSIGLAKQIALHSEMDRKASQKQRELDKAKEKQQEELHKQKQIEKDLE
EQSRLIAASSRPNQPAADGQFLVLSNSQSEDSDVGEEGLKKGESEA
Download sequence
Identical sequences ENSDARP00000080303 ENSDARP00000080303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]