SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000081727 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000081727
Domain Number 1 Region: 202-453
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily POZ domain 4.19e-31
Family Tetramerization domain of potassium channels 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000081727   Gene: ENSDARG00000061288   Transcript: ENSDART00000087293
Sequence length 603
Comment pep:known chromosome:Zv9:8:25779021:25818251:-1 gene:ENSDARG00000061288 transcript:ENSDART00000087293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSVCVSSYRGRKSGNKPPSKSCLKEEMARCEDSDKIIINVGGTRHETYRSTLRTIPGS
RLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFE
EELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDDQDMPRRFGIEDSPDR
SRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHTDT
KSATNSTTIIQVMDTKPVLTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAI
LPFYLERSLIGNTSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFC
LLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDM
VPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHNPNPGMV
LDSGSFGKSESNSPRNSTQSDTCPLAAEENITRNRSDSKQNGDATVTLSEEEGCSLTQPL
SPGERWTLRCSRNRDKTMKDATCFLLNSGDFSCGAEPTIHTESCKDALTSPANYTQAEVT
TLT
Download sequence
Identical sequences E0R7P9
NP_001182125.1.45394 ENSDARP00000081727 ENSDARP00000081727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]