SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082044 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082044
Domain Number 1 Region: 655-884
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-62
Family DBL homology domain (DH-domain) 0.0000000282
Further Details:      
 
Domain Number 2 Region: 254-449
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.97e-56
Family Regulator of G-protein signaling, RGS 0.0000106
Further Details:      
 
Domain Number 3 Region: 885-1020
Classification Level Classification E-value
Superfamily PH domain-like 1.87e-39
Family Pleckstrin-homology domain (PH domain) 0.00000682
Further Details:      
 
Domain Number 4 Region: 2-44
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000021
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082044   Gene: ENSDARG00000067634   Transcript: ENSDART00000087610
Sequence length 1336
Comment pep:known chromosome:Zv9:5:60164514:60230293:-1 gene:ENSDARG00000067634 transcript:ENSDART00000087610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTVLGRPPGLPQIPLSDGEGEE
GSPFSLSSPHSPGPIGPERSCSSPSPSERKAASLPVWGITEDYRNPTSKLLKEIQDIPQN
QNQEQLSKPTGQDESISPRPGEGELEDFSGDVDRPPSWQGDAGTEPLWTNNNMTPVTPCL
FPESPCQRETPCHSPKTTPRDSLNSCPSPDAEDTPDLDSQSSVGSPCSRPVAHIIGAEDE
DFGKEQEQMNGQCSCFQSIDLLKSRPAHLAAFIHHVVSQFDPAPLLCYLYADLYKQSSTK
ETRRILMDTFFIDKTANLKVTVPESIIADLERTAHSTNAERKRPEQMSEDVHRQYVQQLQ
DTLLTDVQKNLEDFRHKRSMGLTLAEAELARLDTERMRDRVALEKERSCAEHILSKIEEV
LLTSQATEEDKCSTMQFVILSYMKQLGVKVKELRGLDHKPKLMNPFHKIKKSMKPEKDGS
EEKAKKTRFPNVFPQRRPSKIDALSQPKQRTPKPQLPLGTGEQADGSSLPVRSSQSSEGS
DGTNALITSPPYSAPAGQGTDAISRESETGGLPSSALPKLGEGTVSGDLQDSSSTNTHFD
FSNCMLEHLQEEEAETEKTQDSGTPRPDRSRMDPLGSGEVQSEDDQCVEAELEPPNWQTL
VSRDVLSTLTPQEIKRQEVINELFYTERAHVRMMKVLENLFYQPLIRDAILPPADIKNIF
SNLEEIVQLHLSLTEQMAAVRKKNETALIDSIGDDLLSWFSEEEEDKIKRAVGTYCSNQP
FALELIKSKQKKDQRFNAFIQETESNRHCRRLQLKDIIPVETLRLTKYPLLLENIAKYTE
DSEERSKVKRAGECCRKILTHVNQEVKEAENKQRLEDYQRRLDLSSLKQSENPMIAEFKS
LDLTKRKMVHEGPLSWKVNKDKTIELYTLLLEDILVLLQRQDEKLILKCHSKNLAGTAET
KHIFSPIIKLSTVMVRSVATDNRSFFVLSMSDNGAQIYELMAQTVSEQKTWQCLITQRAD
CMKTKLHNIIPLPQTDGEREEVEMINSGVQKISKDTEPITLASIQSPVEKDDTEVIPTPL
PSTNPFETKSDEEAEEEEENSLQDQAEDDEAFVVADLSDRLTFLKQRSRLGIAIDEDEAE
VFELQPLIADEALRTLATLRQLLINHFSGQEDTDRENKSEDQQEHIERTCPQQGSDDSAA
IQSPLENGSDRGENPQELPSGDTGFFETSEDCVSAGSYMVLEVFAGSGESSTDDDAQGCS
VEPVAGGDSGIDLKKLLSSSSQSTGGPNINRQIMTHLRLLQGNLQQLKETEIKYNQLRQR
LSEETATDTEENKDKS
Download sequence
Identical sequences ENSDARP00000082044 ENSDARP00000127744 ENSDARP00000082044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]