SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000085450 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000085450
Domain Number 1 Region: 579-891
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.36e-89
Family Protein kinases, catalytic subunit 0.0000000517
Further Details:      
 
Domain Number 2 Region: 102-176
Classification Level Classification E-value
Superfamily HR1 repeat 5.89e-24
Family HR1 repeat 0.0000834
Further Details:      
 
Domain Number 3 Region: 184-260
Classification Level Classification E-value
Superfamily HR1 repeat 1.28e-23
Family HR1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 3-78
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-20
Family HR1 repeat 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000085450
Domain Number - Region: 372-449
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00425
Family PLC-like (P variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000085450   Gene: ENSDARG00000062748   Transcript: ENSDART00000091017
Sequence length 909
Comment pep:known chromosome:Zv9:3:6340747:6391294:-1 gene:ENSDARG00000062748 transcript:ENSDART00000091017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDQNSDFSDSSVQHRLDEKREWIRREIRKELKIKEGAEKLRRATTDKRNAQQVESQLR
SSSRKLDSLHAQLQELDAYIMVKGHDDSKDDIQSVGTPGRSSANQDRIKALERQLNIELK
VKQGAENMIPIYANGVTKDKKLLQSAQQMLQDSKTKIDIIRMQIRKAMQATEQSDDTQGK
PDLCGVELRIEELWHHYRVEHAMAEGAKNMLRLLGTGKAQDKKAIAEAQSRLSEASQRLD
LLRVSLEQRLVNLPEDHPKACLIKEELVRASSSAFSSSHSAPYVHNQYSTLSRPSPLTGT
LQVRLLGCVDLLEMVPGRSRASPVVLPHFSPGDGRAFKLTLSSRSSSFSLKTPSKSEESC
ECLTHILLMSCVCVCVCVKTSGLHTHTHTHTHSVLQSREMEIALYWRDYRSLCALKYLKL
EDFLDNQRHRVQLELEPQGLLLAEVMFFNPVIERGPRLQRQRKVFSKQQGKAFLRAKQMN
VDMATWVRLLKNAITIPTHNYTQHSHTHHSSSEISIQKIQLDGESPPSVTRRNTHTSATV
DFGRAAEPVSPPGPAPPERVVRSISHLSQRRSSKSALCLQDFRMIAVLGRGHFGKVLLSE
YRRSGNLYAIKALKKGDIVARDEVESLMCEKRIFETVNSAQHPFLVNLFACFQTPEHVCF
VMEYTAGGDLMMHIHADVFSETRSVFYSACVVLGLQFLHDNKIVYRDLKLDNLLLDTEGY
VKIADFGLCKEGMGHGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMMVGES
PFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEDIKKQPF
FRNMDWDALLQRKVPPPFVPAVATSEDVSNFDAEFTNEAPTLTPPRERRSLSRKDQDYFK
DFDYVSDFC
Download sequence
Identical sequences F1QXD6
ENSDARP00000085450 ENSDARP00000085450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]