SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000085905 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000085905
Domain Number 1 Region: 241-477
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-53
Family Voltage-gated potassium channels 0.00088
Further Details:      
 
Domain Number 2 Region: 82-194
Classification Level Classification E-value
Superfamily POZ domain 3.14e-27
Family Tetramerization domain of potassium channels 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000085905   Gene: ENSDARG00000062906   Transcript: ENSDART00000091472
Sequence length 527
Comment pep:novel chromosome:Zv9:5:9471688:9483668:-1 gene:ENSDARG00000062906 transcript:ENSDART00000091472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTYQKNRSQSLFPNCKLANSESTDDILPFAKKGLLKHWRSLNELQEDIYNVFDDVYEEE
VQRHAEPTLWFTSTSPSRNCTLNLNVGGKSYRITYKMAARYPQTRLGRLAMSTDLNMKMD
LCDDYVVKDNEYFFDRDPDVFNSIFNFYRTGVLWIKDELCPRNFLEEISYWGVRIKYSQR
CCRILLEEKNDELCEQLKVQKELERELEIEENEEAFDDMILGESRRSLWDFMEKPFSSIP
AKLMAVTSSMFVLISLVTMTLSTVEEMENIESEGKNYGEFVENLCITFFTIEYLLRVIST
PDICRFFKSMLNAVDLMAILPQILQFMLENFETFGSRNQSADMETVGQVGKVGQVLRIMR
LLRIFRVLKLARHSTGLRAFGFTLKQCYQQVGCLFLFIAMGIFTFSAMVYSVEYDVPKTN
FTSIPHSWWWASVSISTVGYGDMYPETLLGRIFAFGCISFGIILNGLPISILFNKFSDYY
AKLKSHECPSHMKNRGNVNFIPRAKKKLRECGCIETNDDTNDDTNVS
Download sequence
Identical sequences A2ARG8
ENSDARP00000085905 ENSDARP00000085905 7955.ENSDARP00000085905 NP_001122212.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]