SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000087343 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000087343
Domain Number 1 Region: 371-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-68
Family SPRY domain 0.0000047
Further Details:      
 
Domain Number 2 Region: 31-105
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-19
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 153-219
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-17
Family B-box zinc-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000087343   Gene: ENSDARG00000040860   Transcript: ENSDART00000092911
Sequence length 559
Comment pep:known chromosome:Zv9:19:4854823:4861016:1 gene:ENSDARG00000040860 transcript:ENSDART00000092911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSPSSTKGKETRRGSLVLPPGMSSSSGPLSEDLRCSICLDVFTDPVSTPCGHNFCKI
CLNKCWNNSQTCSCPYCKETFRQRPDLKINTTLREISEHYKEKRPGEKAEVVCDVCEDRK
LKALKSCLVCQSSYCQTHLEPHLRVAGLKKHKLMDPVRNLEDYICQKHDRPLELFCRDDQ
TCVCSFCTETDHKNHNTVQIEEESRIKKTELMKTQKDVQQMIKDRIKKIQEVKHSAQVRK
IYSEKEKAAHVEIFTDLIRSIERCQTELLEMMEEQQKAAEKQEEELIKELEQEITELKMR
NTELEQLSHTEDHLHLLQSYSSLQSRPADTRNWPEISLKTQENLETLRKTLDHLKDTVEE
KLSQAVSAEVKWVQQYAVDVTLDPDTAHPEIILSDDGKQVKHGDIRQKLPDTPQRFDRCP
CVLGKEGFSSGRFYFEVQVKGKTDWTLGVVRESINRKGSITVSPSNGFWTVVLRNGNEYK
AFAGPSVSLSVGVNLQRVGVFVDYEEGLVSIYDVESSSHIYSYTGQTFTDKLYPFFSPHL
NNGGKNSNPLIITPLHYNK
Download sequence
Identical sequences ENSDARP00000087343 ENSDARP00000025807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]