SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088795 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088795
Domain Number 1 Region: 623-867
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-60
Family Nuclear receptor ligand-binding domain 0.00000000872
Further Details:      
 
Domain Number 2 Region: 509-586
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-25
Family Nuclear receptor 0.0000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088795   Gene: ENSDARG00000067976   Transcript: ENSDART00000098022
Sequence length 868
Comment pep:novel chromosome:Zv9:5:37179505:37297038:1 gene:ENSDARG00000067976 transcript:ENSDART00000098022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPVGLVEACESPDAVFHGPYQSVFQNVRVARASNPESLDISSSKKCGCLQEGSSREMR
LSELSSFRRIICCPEKEYESASSVIQAAASRIHFLKSSSGSKSDSSLSSSGSGRTDATES
SGSRAGFLRVVESGQKGCGAVEVHTRELGSGRDASVASSSRACTTATITSSSSSSSTTTS
CTISETARELCKAVSVSLGLAMESSELGEVGQHHAPPPPPLTTESSEEIYLYGMPLLDCS
VSEREAGRKDREYALAAGRDRGEELRGRDKVLGMLKSGDLEQLAGEVTTLQCSNASRANL
TADVHEFGSLSGDIANLSSEGTAAQTAPDMDGPRAASCQFEQLLPASMTHYAHPELENGP
SHSFVKSTSMSGEFAGPMEDYTNLYNVRIKTEMMPRDLNDTWAYPHRYAEDSNGHYGPPK
QRTPYATGHEPPFICNPYEYGRSTALVPRERPPHEQWYPGGMLTRHPYPNVPGVKNEMGE
WMDVTSFTDGRFDGGRSDIFPMEFFLPPQRTCLICSDEASGCHYGALTCGSCKVFFKRAA
EGKQKYLCASRNDCTIDKLRRKNCPSCRLKKCFEVGMTLGARKLRKIGQMKGPDEVGAVQ
GPSETVQCLSPKPNLTFHSQLIFLNILEAIEPEVVNAGHDHGQPDSAAALLTSLNELGER
QLVKVVKWAKGLPGFRNLHVDDQMTVIQHTWMGVMVFALGWRSYKNANARMLYFAPDLVF
NDRRMHVSSMYEHCVQMKHLSQEFVLLQVTQEEFLCMKALLLFSVIPVEGLKSQKYFDEL
RLTYINELDRLINYGRKTNCAMRFQQLTRLMDSLQPVVQKLHQFTFDLFVQARSLPTKVS
FPEMIAEIISVQVPKMLAGLSKPILFHK
Download sequence
Identical sequences A4GT83
NP_001076592.1.45394 7955.ENSDARP00000088795 ENSDARP00000088795 ENSDARP00000088795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]