SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088820 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088820
Domain Number 1 Region: 372-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-56
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-19
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 143-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-16
Family B-box zinc-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088820   Gene: ENSDARG00000093651   Transcript: ENSDART00000098047
Sequence length 553
Comment pep:known chromosome:Zv9:2:48041230:48047579:1 gene:ENSDARG00000093651 transcript:ENSDART00000098047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEANVFWAKNQFSCSVCLGLLKEPVTIPCGHSYCMNCITDCWNQDEQRRVYSCPQCRQT
FTPRPALNKNVVFAEIVEKLKMTRVQNVDPAPSYAGPGDVECDVCTGMKYKAVKSCLMCL
NSYCQTHLEQHNGFFKDKRHHLINATGRLREMTCPKHDRLLEVYCRTDQKCICLLCTMDE
HKNHDTVSAEAERAEKQKPLGGVQRKFDLRIKRKQKLLYQLKEAVETHKSSAQKAVEDSE
RIFSELIQSIERRRSEVTQMIRDREKTEVSRAEGLLKKLEEEIEDLKRRNTELEQLSHTD
DHIHFLQSIPVLSVPPASSDISVSSLHSYDDVGKSISELREKLEDLCKEDIQQIFGKVTC
INSVYLHELKTRDEFLQYSCHLTLDLNTAHKYLRLSEGNRVATFIGADQSYPAHPDRFHD
FSQVLCRESVCGRCYWEVEWSGEAGVGISVSYKSIRRKEETNDSVFGYNGQSWRLSCSNS
SYKFRHNSNVVDLPVSSKSSKIGVYVDHRAGILSFFSVSDTMSLIHRVQTTFTQPLYPGF
GINFGSTIKLLLL
Download sequence
Identical sequences ENSDARP00000088820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]