SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089056 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089056
Domain Number 1 Region: 375-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-59
Family SPRY domain 0.00028
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-21
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.01e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089056   Gene: ENSDARG00000053293   Transcript: ENSDART00000098284
Sequence length 565
Comment pep:novel chromosome:Zv9:2:43232265:43236818:-1 gene:ENSDARG00000053293 transcript:ENSDART00000098284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSISVAQDQFSCSICLDLLKGPVTIPCGHSYCMSCILDCWDQDEQKGVYSCPQCRQT
FTPRPALGKNTMLAEVVEKLKKTKLQAARPAQCYSESADVECDVCTGDKNKAIKSCLVCL
NSYCQNHLEQHESFFRGKKHNLMDATGRLQEMICSQHDKLLEIFCRTDQCCICYLCTMDK
HKSHDTVSAAAERTDKQRQLEETQSKLHQRIQRKLKECEELRAAVESHKRSAQAVVEDTE
RIFTELICSIEKSRSEVMQLIRDQEKAAVSGAEGRLERLKQEIDDLRRRDAELEQLSHTD
HHIHFLQSFQSLSTPPGSTDSSSITVSSPLSFDDVGKSVSRLREKLEHFCREEIKKISGK
VREITRISKPEPKTREDFLQYYGPLTLDPNTVNNYLLLSEGNRVFEYTSKDNQYPDHPDR
FDCWLQVLCRESVCGRCYWEVEWSGRGVSISVAYKSINRKGEGTECVIGRNDQSWSLSCS
DSSCSFWHNNKHTKLPVMSISSRIGVYVDHSAGTLSFYSISDTMNLIHSIHTTFTQPLYP
GFRINSLYFLLSKSKPKIKLSDVKM
Download sequence
Identical sequences F1QHA1
NP_001038735.2.45394 7955.ENSDARP00000089056 ENSDARP00000089056 ENSDARP00000089056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]