SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089263 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089263
Domain Number 1 Region: 27-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.39e-91
Family Calponin-homology domain, CH-domain 0.000000921
Further Details:      
 
Domain Number 2 Region: 284-405
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-36
Family Spectrin repeat 0.0000587
Further Details:      
 
Domain Number 3 Region: 592-731
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-29
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 893-1047
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-29
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 5 Region: 1001-1155
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-28
Family Spectrin repeat 0.0000227
Further Details:      
 
Domain Number 6 Region: 1212-1365
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-28
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 7 Region: 414-516
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 8 Region: 728-844
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-21
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 9 Region: 518-626
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-21
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 10 Region: 1373-1415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000417
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089263   Gene: ENSDARG00000036402   Transcript: ENSDART00000098492
Sequence length 1416
Comment pep:known chromosome:Zv9:11:44145729:44210549:-1 gene:ENSDARG00000036402 transcript:ENSDART00000098492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEWASGGPEGFYQEPSFPAQVPFNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARV
SCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLE
NMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYP
NVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLL
DPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLA
SDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQS
KMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKA
AMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETE
NYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLL
LSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRD
RVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLT
GAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQ
LASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDAST
EVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALAL
YKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI
ARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWI
REKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAK
AITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMP
NTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGW
NELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ
EDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRL
KDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLD
KIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCAD
LDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLEN
Download sequence
Identical sequences ENSDARP00000089263 ENSDARP00000089263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]