SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090626 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090626
Domain Number 1 Region: 113-164
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000811
Family Elafin-like 0.0036
Further Details:      
 
Domain Number 2 Region: 516-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000578
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 330-411
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000166
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 4 Region: 419-527
Classification Level Classification E-value
Superfamily SEA domain 0.0000085
Family SEA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090626   Gene: ENSDARG00000068923   Transcript: ENSDART00000099853
Sequence length 950
Comment pep:putative chromosome:Zv9:10:33568497:33594732:-1 gene:ENSDARG00000068923 transcript:ENSDART00000099853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHWVVGAWVITLLFGFGRGHNTLIEGYEQTLSGYHLCNMTELVSMTRVVSYPSPYTQRRA
CGGWLPWNMCDVTVYKTAYQTEVYYISRQVKTCCHGYEQVGSYCALPLNRSAEFTSKPGL
CPSARATGNHSDSGTVCNWDTDCPQWQKCCQTENNSSISRCLEPVPAANRTWCFNVTITV
RTTYELLAIDKGLLNHTRLLHSVVTGALGNAEFSVHHVWSWSAGLFATSSSLLVCASKDF
SIEDISAKLYQLGNIEEVTNVVVQVPSVIAEPFINTTTPSLITRSASGTNMFIGEPSSTV
TSGPFWTSSHSYNPTSSPPSSTCDGVPEITRIFSYDVTASSFHVEWITKTQTGVTFLLLL
QKNGTAVHAWNDVTSFNWTFTDLNPAALYTVRVTPSACGIQGNPVEIKVRTDGQLLGATV
RLTNVMYTEALSDPNSAAYKEFCDSFINETRLSLPPEILELLLSRKLILQITSISPGSII
VNFTIIFQPGSNLDIRNISNALMNSLQNSTKYVIDKNSIHISDLNECLLAEADCSRWAHC
INTEGSYSCDCWSGYIDLNPRRPGRSCAASSNATASTVHPATNYTELSSAAITGNPSVSR
TNVQSNLTTTTMSSASSTYANRLIQAISPATTLNITCHSVSCITVECSPWLIKVDIRRDY
LKANNISETSLYLGNPECGPVGFDDSYLWLITAWDKCGTTPEHNNTHNSFSVTLFNNVSS
SQTTTHLKVPVTCTYPSSVIISMGYAPAGYFEMINDPVNGWGSFEVLMRLLNGTHPLPEN
YTISQNENIFVEVGVNTTISQIKTVINKCWATSSSDSSQPSNYVFLDNGCPVPEKHTNVL
QNGNGTVSLVAVQIFSVVNLDFVFLHCEIQICIAFQDSSCIPACDRLLSARSSKLFGLTR
SVGPLNRLHTTTFQSDTSNTVQAVGFVLLGVGVFLLSLTVIAGLLYQKRK
Download sequence
Identical sequences F1QWI9
ENSDARP00000090626 ENSDARP00000090626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]