SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000091431 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000091431
Domain Number 1 Region: 171-431
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-69
Family Nuclear receptor ligand-binding domain 0.0000000543
Further Details:      
 
Domain Number 2 Region: 97-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-31
Family Nuclear receptor 0.00000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000091431   Gene: ENSDARG00000069266   Transcript: ENSDART00000100658
Sequence length 436
Comment pep:known chromosome:Zv9:21:26014354:26027586:1 gene:ENSDARG00000069266 transcript:ENSDART00000100658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRERRSDLYIKAEPSSPEGGGGGGGGRTSPGGASSDSSQSGGGGSRGEGAGRYSPPLY
TPALRCHFKEEGADGAEEGSTGSGGGRCKYALSTLPKRLCLVCGDVASGYHYGVASCEAC
KAFFKRTIQGNIEYSCPASNECEITKRRRKACQACRFTKCLKVGMLKEGVRLDRVRGGRQ
KYKRRPEVENATYQSAPIPLRKEGEKGSSSIIVSHLLVAEPEKLFAMPDPLQPDTAQRTL
TTLCDLADRELVVIIGWAKHIPGFLSLSLADQMSVLQSVWLEVLVLGVAYRSLGCEDEVV
FAEDFVLDEEMSRVAGLTELNAAISQLARRFRALQLDREEFVMLKAIALTNSDSVYIEDM
EAVQKLRDLLHQALLELEVQRRPDDPQRAGRLLLTLPLLRQTAGRALTTFYSIKTRGGVP
MHKLFLEMLEAMMDSP
Download sequence
Identical sequences Q6Q6F6
NP_998120.1.45394 XP_009293748.1.45394 ENSDARP00000091431 7955.ENSDARP00000091431 ENSDARP00000091431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]