SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092009 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092009
Domain Number 1 Region: 372-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-50
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-21
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 3 Region: 142-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.4e-16
Family B-box zinc-binding domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092009   Gene: ENSDARG00000069514   Transcript: ENSDART00000101235
Sequence length 574
Comment pep:known chromosome:Zv9:3:5199297:5208959:-1 gene:ENSDARG00000069514 transcript:ENSDART00000101235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGVSWAEDQFMCPVCLDLLKSPVTIPCGHSYCMSCITDCWNQEEQKRIYSCPLCKQS
FTPRPALAKNVVFAEMVEKLQKSRLQTAAPASVHTGSGDVECDACTGNKQKAVKSCQECR
NSYCPDHLQHHESLFRGRGHNLMEATGRLQEMICPQHNKVMEIYCRTDQRCICMLCLVDG
HKHHDTVTIAVARTEKQRQFEEAQRNIQKQILEKKKDLKQMRDAMESHKHSAQMTVEDSE
RVFAELIRDIEKRRSEVTKMIREQVKAARSRAEEHVARLELELDNLRFKDSELKKIVETK
DHINFLKSCPSVSVSGSSDNVTVSSCPSFNEVMKSISQLRNKLQQFFNEEMDNISKKVKT
VQVVVSREHATRKEFLQYSHPLTLDLNTVNYCIDLREGNTIMTVTNIRQPYPDHPHRFDA
WTEALCREPVTGRCYWEVEWAGTGRKGVDIGVMYRSMKRKGDGNDSAAGRNEKSWSLFCS
PEYCSFWHNNRETVLPVSSVSSKIGVLVDPSAGVLCFYSVSDTLSLIHRVQTTFTQPLYA
VFGLDRQTVLKLPNQINDADIIQLAMLYHTLMMS
Download sequence
Identical sequences E7FAW4
XP_021330504.1.45394 ENSDARP00000092009 ENSDARP00000092009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]