SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092118 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092118
Domain Number 1 Region: 227-469
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-48
Family Voltage-gated potassium channels 0.0012
Further Details:      
 
Domain Number 2 Region: 72-183
Classification Level Classification E-value
Superfamily POZ domain 7.59e-28
Family Tetramerization domain of potassium channels 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092118   Gene: ENSDARG00000061493   Transcript: ENSDART00000101344
Sequence length 521
Comment pep:known chromosome:Zv9:23:39422864:39478109:1 gene:ENSDARG00000061493 transcript:ENSDART00000101344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLAGDGSDYDYSALSCTSDTSLNAPPVHEQEALKGVYYKRAQRLPPTDPNFTDALHPD
ASLPSCAQRLHVIINVGGLRYQFPWTTLEDFPLSRLGQLRLCSTFDEIMHICDDYDVVHN
EFFFDRSPCAFRTILTFLRAGKLRSLREMCALSFQEELLYWGVPEESLEWCCRRRLLQRV
EECDELERVAEEDEEDEDDSESGLARESRLGRCMGKLRDMVEKPHSGLPGKIFACLSVLF
VTITAINLSISTMPAMREEEETGKCSQMCYNIFIVETVCVAWFSLEFTLRFIQDRSKLAF
LRRPLNLIDVIAILPYYITLVVDSTSTGEKRLGSGSSYLDKVGLVLRVLRALRILYVMRL
ARHSLGLQTLGLTARRCTREFGLLLLFLCVAIALFSPLLYLIENEAAATREFSSIPATYW
WAVITMTTVGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYVELKQEQQR
LLQRRTHFLLRSRIAGLGSDLSLESDVLFPSVSSEHRNREE
Download sequence
Identical sequences A8WG04
ENSDARP00000092118 ENSDARP00000092118 NP_001103880.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]