SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092330 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092330
Domain Number 1 Region: 541-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.7e-69
Family Ankyrin repeat 0.000000338
Further Details:      
 
Domain Number 2 Region: 33-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-64
Family BAR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 420-537
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000456
Further Details:      
 
Domain Number 4 Region: 308-402
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-20
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 5 Region: 954-1022
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000919
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092330   Gene: ENSDARG00000019564   Transcript: ENSDART00000101556
Sequence length 1024
Comment pep:known chromosome:Zv9:20:29660561:29701366:1 gene:ENSDARG00000019564 transcript:ENSDART00000101556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQLTVTEFVDITHEDYKAPTTSVFCTRMAHCRNTVAALEEALDLDRSVLHKMKKSVKA
INSSGQTHVENEEQYIQAIERFTDNTVYKDDPEMSNYFLTFAGFTKELTALFKNLLQNMN
NIITFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKLSKIEKEKREHAKQHGLIRTEISG
GEIAEEMEKERRLFQLQMCEYLIKVNEIKVKKGVDLLHNLIKYFHAQCNFFQDGLKVVDN
LKPFMEKLATDLTANKQTQDAERKQLLQLKETLKSALQSECKEDAQSKQNAGYSLHQLQG
NKAHGTERSGMLLKRSEGLRKVWQKRKCSVKNGLLTISHGTPNAPPANLNLLTCQVKRNP
DEKKCFDLISHDRTYHFQTEDEAECQVWVSVLQNSKEEALNNAFKDDQNEGENNIVRELT
KAIVGEVKKMSGNDVCCDCGASNPTWLSTNLGVLICIECSGIHREMGVHYSRIQSLTLDL
LGTSELLLANSVGNAAFNEIMEAKLSSEIPKPNPSSDMQVRKDFITAKYTEKRFAQKKYA
DNAARLHALCDAVKSRDIFSLIQVYAEGLDLMETINQPNQHEPGETSLHLAVRMVDRNSL
HIVDFLVQNSGNLDKQTAKGSTALHYCCLTDNSECMKLLLRGKASVSITNDAGETALDLA
QRLKHSKCEELLTQAQTGKFNVHVHVEYDWRLHNEDLDESEDEMEDKPIPIRREERPISC
IVPGSGPMMPNMSALARDVANVVNNKQRAFIPSMMMNETYGTMLDPNSPPLGLPGVPGIP
LLPPRPLGRGWSPPMENIGRQRSCSDPANPQTPEQNNSVYVLPPAPPPPPAPKRPPPPDP
KASLLPPAATAPPAPSAPLLIPPAPLRPAPVVPPAPVMPTSFSYKPPPPPVPVQPKAPAS
KPVKSPTRDAIGSFSKIVSVNKAPPIGPQSSDKTDAPLSASAQATAPVPAPEPKPRTAPP
KQRPKRVKALYNCVADNADELTFSEGEMIIVDGEEDKEWWVGHIDGEPTRRGVFPVAFVH
FVTD
Download sequence
Identical sequences Q5TZC7
ENSDARP00000092330 7955.ENSDARP00000092330 ENSDARP00000092330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]