SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092411 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092411
Domain Number 1 Region: 367-551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-66
Family SPRY domain 0.00000571
Further Details:      
 
Domain Number 2 Region: 27-99
Classification Level Classification E-value
Superfamily RING/U-box 9.06e-20
Family RING finger domain, C3HC4 0.0033
Further Details:      
 
Domain Number 3 Region: 150-216
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.19e-16
Family B-box zinc-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092411   Gene: ENSDARG00000058329   Transcript: ENSDART00000101637
Sequence length 556
Comment pep:known chromosome:Zv9:15:17155795:17161832:-1 gene:ENSDARG00000058329 transcript:ENSDART00000101637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESTSGSPKHNPARRSSLDAPPLSLSALSKELQCSICLDAFTDPLSTPCGHNFCKSCLN
QCWNNSQTYNCPFCKDTFSYRPELKINTALRQLVQVFRQNVPEKKSEVLCDICDGMKMKA
FKICLTCQSSYCETHLEPHQRVPNLKKHTLIDPEGNVENYICKKHEKPLELFCRDDQTSV
CSLCAVTDHRNHNTVVVEVESKEKKPQLIKIQTDVQQMIQDKLKKIQEIRHLEELRMITS
EKEKAESTELFADLIRCIKICQSELLEMKEQKQKAAEKQAQELIKDLEQEITELKRRDAE
LEQILHTEDHLHLLQIYPELSKPPHTSSWTHVSISDTQLSVETLRKTLTQLQDTLNDKLS
TSVSTVLKTMQQHAVDVTLDPNTAHPKLILSDDGKQVTFGDKELKLLNNPERFDCCPCVL
AKERFSSGRFYFEVQVKEKTDWDLGVVRESINRKGDITAAPEAGYWIIMLRNENQYLAID
SSSVSLSLRVKPQVVGVFVDYEEGLVTFYDVESGSFIYSFTGQTFSEKLSPYFSPYQNNG
GRNTAPLIISHVRKNE
Download sequence
Identical sequences ENSDARP00000092411 ENSDARP00000092411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]