SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093027 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093027
Domain Number 1 Region: 742-888
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-39
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-36
Family Spectrin repeat 0.0000652
Further Details:      
 
Domain Number 3 Region: 102-251
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-35
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 4 Region: 1290-1440
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-34
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 1612-1769
Classification Level Classification E-value
Superfamily Spectrin repeat 1e-33
Family Spectrin repeat 0.00000233
Further Details:      
 
Domain Number 6 Region: 1828-1982
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-32
Family Spectrin repeat 0.00000358
Further Details:      
 
Domain Number 7 Region: 416-571
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-32
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 8 Region: 1402-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-31
Family Spectrin repeat 0.0000364
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-30
Family Spectrin repeat 0.0000108
Further Details:      
 
Domain Number 10 Region: 256-360
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-27
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 11 Region: 1932-2087
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 12 Region: 2093-2207
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-26
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 13 Region: 2316-2453
Classification Level Classification E-value
Superfamily EF-hand 9.45e-23
Family Calmodulin-like 0.005
Further Details:      
 
Domain Number 14 Region: 2209-2324
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 15 Region: 967-1030
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 16 Region: 885-962,1051-1094
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-20
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 17 Region: 1061-1176
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000093027
Domain Number - Region: 362-425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000834
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093027   Gene: ENSDARG00000019231   Transcript: ENSDART00000102251
Sequence length 2480
Comment pep:known chromosome:Zv9:21:11352584:11419552:1 gene:ENSDARG00000019231 transcript:ENSDART00000102251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDISGVKVLETADDIQERRQQVLDRYRRFKELSVVRRQKLEDSYRFQFFRRDADELEKWI
QEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAEAIIKLDETGNLMISEGHFASETI
RTRLEELHRLWDLLLQKTKEKGIRLLQAQKLVQYLRECEDALDWISDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAGKLTQENHPEAELILKKQEEVNSAWQRL
KGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALNDKVNTLGGEADRLQQTHPQNATQIHLKRDELITNWEQIQTLATERHARLNDS
YMLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKST
DEAGQALLNTGHYASEEVKEKLGILSEEKVSLLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
KDDVATRRDALLSRRNALHERAQFRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELVDGKHYASSEVSTRMDEVSSQW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDFGKDLTSVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDADNIRKKQEALVARYEALKEPMAARKQKL
SDSLRLQQLFRDVEDEETWIREKEPIASSTNRGKDLIGVQNLLKKHQALQAEISGHEPRI
KAVTQKGEAMIDEGHFAGEDVKAKLQELHNRWDGLKGKAAQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALKEEAQACRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPTQSSSRENLLDEQGSIGLRQDQIENQTAATKEVCSVSMRMKQVEELYGTLLELG
EKRKDMLEKSCKKFMLFREANELQQWINEKESALTNEEVGSDLEQVEVLQKKFDDFQKDL
KANESRLRDINKVASELESEGLMAEEAPVVQAQQVEVLGSAPGKDEADSKGASPWKSVRL
AVQTTANFNTIKELNNRWRSLQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALN
TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTEL
NTAWSSLVGRADQRKEKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEAL
LERHQEHRTEIDARAGTFLAFEQFGQQLLARGHYASPEIKQKLEALDRERADLEKAWVQR
RMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQ
EEKIAALQSFADQLISADHYAKPEIFKRRSEVLDRWLRLKAQMIEKRSKLGESQTLQQFS
RDVDEIEAWISEKLQTATDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDT
GNALIQRGACAGSEDAVKARLNALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDF
WLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDT
SQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDY
GRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLETGKKLSDDNTIGQEEIQQRLAQFVEHW
RELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKH
EAFETDFTVHRDRVNDVCSNGDELVKKENHNVENIMAKMKALRGKVLELERAAAQRKAKL
DENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEG
ITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQDHFRKVEDL
FLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALRDAHDAFRSSLSSAEADFSQLAE
LDRQIKSYNVVSNPYTWFTMEALEETWSNLQKIIKERELELQKEQRRQEENDKLRQEFAQ
HANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAM
EEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMF
KHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDIVDPNRDGNVSLQEYM
AFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSK
GREIPSAFDFVEFTRSLFVN
Download sequence
Identical sequences F1R446
ENSDARP00000093027 ENSDARP00000093027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]