SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094423 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094423
Domain Number 1 Region: 232-475
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.87e-51
Family Voltage-gated potassium channels 0.0015
Further Details:      
 
Domain Number 2 Region: 71-178
Classification Level Classification E-value
Superfamily POZ domain 2.88e-27
Family Tetramerization domain of potassium channels 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000094423
Domain Number - Region: 185-227
Classification Level Classification E-value
Superfamily HBS1-like domain 0.0667
Family HBS1-like domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094423   Gene: ENSDARG00000035961   Transcript: ENSDART00000103646
Sequence length 546
Comment pep:known chromosome:Zv9:19:12129824:12169950:-1 gene:ENSDARG00000035961 transcript:ENSDART00000103646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQEVAFLAGSTDHQFTSFHFNPLENKHEISSKKGVFYKRAQVQRKATAQEDEVHRNRGA
GADEGSLFDRTAIINVGGIRYRIPWSTLEEFPLTRLGRLHNCNNAEEILDLCDDYDARCN
EFFFDRSPSAFRSIVTFLAAGKLRLLREMCALSFQEELSYWGVEEASLEWCCLRKLRLRQ
EEQRERLRLEEEEAELTSPHSCEEAPAVGSPEEGRLSGCMHSLRDMVENPHSGIPGKIFA
CLSVVFVAITAVTLCVSTMPDLREEEERGECSQRCYNIFVLETVCVGWFSLEFLLRFIQT
QSKCTFLRTPLNIIDVVAILPYYITLIVDSMSVGDRPAGSGNNYLEKVGLVLRVLRALRI
FYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLCVAMALFSPLVFLAESELGAKQEFTS
IPGSYWWAVISMTTVGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLEL
KEEQNRATRHKPDSQDSTKSQNSEDSQDTDSSIHGITETTAVSALHRRSVAVASQGAPQL
RRSLKS
Download sequence
Identical sequences E7FFQ6
ENSDARP00000094423 ENSDARP00000094423 XP_690900.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]