SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094478 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094478
Domain Number 1 Region: 367-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-53
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-21
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 138-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.56e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000094478
Domain Number - Region: 108-312
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family FCH domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094478   Gene: ENSDARG00000030954   Transcript: ENSDART00000103703
Sequence length 561
Comment pep:known chromosome:Zv9:19:13020679:13026716:-1 gene:ENSDARG00000030954 transcript:ENSDART00000103703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESRFSQEQFSCPVCLELLKNPVAIPCGHSYCMSCITDYWHHEDEKRVYSCPQCRQTFS
PRPALNKNTMLAEVVEQLKKTKHHTAAVPAGDGDVECDSCTGRKHKAIKSCLVCLNSYCQ
NHLEQHENLFKGKRHNLIDATGRLQEMICRKHDKLLEIYCRTDQRCICMLCMVDEHKDHE
TVSTSAERTEKQKQLGEIQRKFQQQIQKRERKLQELNEAVKIHERSAQTAVKDSERVFSE
LIRSIERKRSEVTQMIRDQEKITVGRAEGLLKQLQQEIDDLRGKNAKLEQLSHTHDHICF
IQSFASLPVPPASPDVPSITVSSYDDVGKSVSQLRQKLEDFCREETENISGQVTCIQIIP
TPEYESRNDFLQYFCHFSLDPNTAHQCLCLSERSRVVTLSSRQNYPDHLDRFDQCRQVLC
RESVCGRCYWEVEWSGNVDISVSYKSISRKGEGDVQCRFGCNDQSWSLSCSRSSCSFRHN
DIKTDLAVVPGNRIGVYVDHSAGILSFYSVSDTMTLIHRVHTRFTQPLYPGFRFLHVFVG
ILKQVLDNFSGETARVKLCDR
Download sequence
Identical sequences Q1LXS0
XP_003200605.1.45394 ENSDARP00000094478 7955.ENSDARP00000094478 ENSDARP00000094478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]