SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094891 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094891
Domain Number 1 Region: 123-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.16e-87
Family Nuclear receptor ligand-binding domain 0.0000000173
Further Details:      
 
Domain Number 2 Region: 20-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.08e-29
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094891   Gene: ENSDARG00000070721   Transcript: ENSDART00000104116
Sequence length 422
Comment pep:known chromosome:Zv9:6:38885926:38908301:-1 gene:ENSDARG00000070721 transcript:ENSDART00000104116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAVSTSTQVPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTCP
FNGSCTITKDNRRHCQACRLKRCLDIGMMKEFILTDEEVQRKKELIQRRKDEEAHREAQK
PRLSDEQRNIIDTLVDAHHKTYDDSYSDFSRFRPPVREGPVTRSASRAASLHSLSDASSD
SFSHSPESGDRKMNLSNLLMMYQEQGLSSSPDSKEEDGSSLSMLPHLADLVSYSIQKVIG
FAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFSLEDMSWSCGGPEFKYCVNDVTKA
GHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHVRVEALQDKVSEVL
QAYIRAHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGGQ
VT
Download sequence
Identical sequences Q1L673
NP_001153457.1.45394 XP_005166104.1.45394 ENSDARP00000094891 ENSDARP00000125655 ENSDARP00000094891 7955.ENSDARP00000094891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]