SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095878 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095878
Domain Number 1 Region: 354-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-59
Family SPRY domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 28-101
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-19
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 148-214
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.05e-17
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095878   Gene: ENSDARG00000069982   Transcript: ENSDART00000105107
Sequence length 539
Comment pep:known chromosome:Zv9:19:1514533:1520943:1 gene:ENSDARG00000069982 transcript:ENSDART00000105107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSQKGRQIRRKSLDFPPDMSSSGGPLSEELQCSVCLEVFTDPVTTPCGHNFCKTCLN
KCWNDSETCSCPYCKETLNQRPDLKINTTLREISDRYKQKSPDGGAVVACDLCEDRTAVK
SCLVCQSSYCETHLQPHLKEAALKKHMLMDPVSNLEDYICQTHQRPLELFCRDDQTCVCL
ECVVTDHKTHNTVPLEMESKEKKAQLMKTQRDMQKMIQDINKEIEDIKHSAEARRLQESK
VMNIHIKGAMDMIEANHRASTEVLELMEEQDSERMSALEQEISELESRNTELEQLSHTED
HLHLIQIHSSLSSFRNTRSRSEISWKTHETLKRALIKLKESIDEKLEQTASEELKWMQQY
AVDVTLDPDKGHSDLKLSDDGKQVRFRDILPNYSSKPQRFDRNLFVLGREGFSSGRFYFE
VLVKEKTDWTLGVARESTDRNKEITVSPRTGCWTVALINGNDYRACNDPPVSLSLRVTPQ
RVGVFVDHEEGLVCFYEVETSCHIYSFTGESFHDTLYPFFSPGPNPCGKNSAPLIITPV
Download sequence
Identical sequences ENSDARP00000095878 ENSDARP00000095878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]