SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096523 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096523
Domain Number 1 Region: 387-709
Classification Level Classification E-value
Superfamily DNase I-like 2.75e-53
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000587
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-27
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1164-1224
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000034
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096523   Gene: ENSDARG00000001442   Transcript: ENSDART00000105745
Sequence length 1226
Comment pep:known chromosome:Zv9:14:33619348:33650873:1 gene:ENSDARG00000001442 transcript:ENSDART00000105745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAPWYHRDISRVRAEELLAHAGIDGSFLVRDSESVPGAYALCLLFQRHVHTYRILPDA
DGLLAVQATQGVQVNCFRTLGDLVLGYQNPNKGLVAPLLYPVMRESEANDESSDGDDEKP
GSTFANSPPRAISPTATSPPSSSAAPHLLLQRLQELSPNSVGCEIVSLLDEYLHGNVCKD
LENLKGGASGLQHFQGILSHICDSLHSEIDQTLSSLETLAKVFDHPSGHLTFSTMQNTGK
SPEENMDNLLQKLTTLCNLLSSLEKRVLKALQEAVANHNLSLQPATPPESSRAPKKLARP
NPVHSFQVKVVRYGRQTVSVDINEGVLLFDKKSGSFGVETVTLDRILQLVKFQRGPAKLK
MVVDSHHNPPRELVFESTKKREAFCRLLQLMKTTHSQKSELDVISVFVGTWNMGGTPPPG
SLQSWVTCSGLGLTPDESISSLPHDIYAVGTQDNPQGEREWAEHIRATLRTSTNIDYKQV
AVQSLWNIRLAVFVKPEHEARISQVNTASVKTGLGNTLGNKGAVGVSLLFNGTSMGFVNC
HLTSGSDKALRRNHNFQDILRLLSLGEKQLSTFDISLRFNHLFWCGDLNYRLDLDALDIL
KHVSKREFEELMCADQLTRERHKRKAFFNFKEEKIMFPPTYRYERGSRDCYLWQKYKSSG
VQVNGPSWCDRVLWKSYPESHVICTSYGCTDDIFTSEHSPVFATFEVGVISQFPRTESCS
ERASIELEAIEAIVKTSSKAKFFIEFHSRCLEEPRRSAENDSQYCEVPGFLKLGWSSKQL
PKLHPVFLDLEHLRDQHLLLSVKSCDGFESYGECCVALRPTAGKLLDTFETCLTHRGEEM
GSIRGRFRVYVPPDRRRIRERVYEWLSIEKDEREMMKDQLSPPSSSAFSIKAPSASYVAS
PNSYTNPAYFIFEEMPVFRKAEEIPSTIKESQVVCANNTVIQLPRVTGSHGHGKRSARRS
DFTEIEIPGSLAPYKPSCETQSELSSTASSYQLFPGPHVPSTSPNQRHTTHSSNSSLQLQ
SHKNNMAPDSELSGKKLTNSYMNHSVFSRDMHKEKVRQDYQGVHQGRPVPIRNGPKLYPY
VSTRVPAQSSASWIVEQPTPASGDNSLTALQIAKSLSEVDFQPADKKYPFHQMPSQQRQH
GYDYGLASERNYSWEKEVSVLHGAPETVRELLSTLGLQRYTLDLSRSGWDDLDYFSGITE
EELCAAGVSNPSHRRRILENLPKIWD
Download sequence
Identical sequences A0A140LH62
ENSDARP00000096523 ENSDARP00000096523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]