SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097330 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097330
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.11e-24
Family Hormone receptor domain 0.00049
Further Details:      
 
Domain Number 2 Region: 122-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000011
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097330   Gene: ENSDARG00000071837   Transcript: ENSDART00000106552
Sequence length 411
Comment pep:known chromosome:Zv9:12:6003440:6012547:-1 gene:ENSDARG00000071837 transcript:ENSDART00000106552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFYHAFMIWTFTVTCEGVKTVHPECWIVLHLQEKEAECLVKMSLLNINGTNAGCLVEWD
GVNCWPAVSVGERVSVSCPPLLKSHELISRTCTSKGWSNMSVPYYIACFQDNSTEEEEIG
HISEYFARVKLIYTVGYGMSLSSLCIAVFIFCIFRKLLCTRIYIHLNLFSTFILRALAVF
VKDAVLFADETVNHCTVSTVLCKASVTFFQYCVLSNFYWLLVEGLYLQTLLTFTFAHKRT
FFWCYTLVGWGTPSVTVTIWTFLKYSYDDYGCWDDLDSGFWWIIKIPILLSVLVNFLMFI
NISRIIIVKTKTPDSNGGDKRFYRRLAKSTLLLIPLFGVHYIVFALFPEHVGLEARLFFE
LVLGSFQGFIVALLYCFLNSEVQNEIRKEIEKYKSRTDINTFHMATQDFIA
Download sequence
Identical sequences A9Y366
ENSDARP00000097330 NP_001106975.1.45394 ENSDARP00000097330 7955.ENSDARP00000097330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]